KEGG   Pasteurella multocida 36950: Pmu_06470Help
Entry
Pmu_06470         CDS       T01729                                 

Gene name
trpC
Definition
(GenBank) tryptophan biosynthesis protein TrpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmp01100  Metabolic pathways
pmp01110  Biosynthesis of secondary metabolites
pmp01130  Biosynthesis of antibiotics
pmp01230  Biosynthesis of amino acids
Module
pmp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pmu_06470 (trpC)
Enzymes [BR:pmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pmu_06470 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Pmu_06470 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI BtpA
Motif
Other DBs
NCBI-ProteinID: AET15562
Position
complement(668670..670079)
Genome map
AA seq 469 aa AA seqDB search
MTQALPSILQKIIQDKTTWIAEKQAQLPLASFQDQLERSDRDFYQAMQQGSKQRPSYILE
CKKASPSKGLIRAAFDLTEIAEVYQHYATVISVLTDEKYFQGHFADIAQVRQRVTQPILC
KDFILSEYQVYLARYAQADAILLMLSVLNDERYTQLATLAHQLGMGVLTETSNEAEFARA
LALKAKVIGVNNRNLHDLSVDIQRVAQITQHYADQIPPRTKIISESGIYQHQQIRDLRHV
ADGFLIGSSLMQHADLNHAVRSLLFGEHKVCGLTRPQDVRAVYQQGALYGGLIFVTHSKR
CISLRQAQELVTQAPLRFVGVFQDQSIAFICHLATQLRLHAVQLHGNESHEFIRQLRDEL
PVNCEIWRAICIESSGTSPCQIVENENIDRYIFDSKTHQQRGGTGKTFDWQLIPHHLKPK
SMLAGGITPENIPLALAQGCLGLDLNSGLETYPGVKSHQKVVAAFAQLR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagcgcttccctctattctgcaaaaaatcattcaagataaaaccacttggatt
gcagaaaaacaagcacaattgcctttagcaagctttcaagatcagctagaacgtagtgat
cgtgacttttatcaagcgatgcaacaaggctcaaaacaacgcccttcatatatcttagaa
tgtaaaaaagcctctccctcaaaaggcttaattcgtgcagcgttcgatttaaccgagatt
gccgaggtttatcaacactatgctacggtcatttccgtcttaaccgatgaaaaatatttt
caagggcattttgctgatattgctcaagtacgccaacgcgtgacacaaccgattttatgt
aaagattttatcttatccgaataccaagtatatttagcacgatacgcacaagctgatgcc
attttattgatgctttccgttcttaatgatgaacgctatacacaattagccacattagca
caccaattagggatgggcgttttaactgaaaccagtaatgaggcagaatttgcgcgcgca
ttagcgttaaaagcgaaagtgattggtgtcaataatcggaatttacatgatctcagtgta
gacatacaacgtgttgcccagatcactcaacactatgccgatcagattcctcctagaacc
aaaattatcagtgaatctggtatctatcaacaccaacaaattcgagacttacgccatgtt
gccgacggttttttaattggcagtagtttaatgcaacacgcagatttaaatcatgcggta
cgctcacttctttttggggaacataaagtttgtgggctcacccgtccacaagatgtaaga
gcggtttaccagcaaggtgcactttacggtggactgatttttgtgacacactcaaaacgt
tgtattagcttacgtcaagcccaagaattagtcacacaagccccattgcgctttgttggg
gtatttcaagatcaatccatagcgtttatctgtcaccttgcaactcaattaagactccac
gccgtccaattacatggcaacgaaagccacgaattcattcgccaattacgcgatgaattg
ccagtgaattgtgaaatttggcgcgccatttgcattgagagtagcggcaccagtccgtgt
caaatcgtagaaaatgaaaatattgatcgttatatttttgacagtaaaacgcatcaacaa
cgtggcggaacggggaaaacatttgattggcaattgatccctcatcacttaaaaccaaaa
agtatgttagctggtggtattacaccagaaaatatccctctggcgctcgctcaaggctgt
ttaggactggatttaaattcagggcttgaaacttatcctggtgtaaaatcacaccaaaaa
gtcgttgcagcttttgctcaactccgctaa

DBGET integrated database retrieval system