KEGG   Pasteurella multocida 36950: Pmu_16730Help
Entry
Pmu_16730         CDS       T01729                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00620  Pyruvate metabolism
pmp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pmu_16730 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmp02000]
    Pmu_16730 (oadA)
Enzymes [BR:pmp01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Pmu_16730 (oadA)
Transporters [BR:pmp02000]
 Other transporters
  Primary active transporters [TC:3]
   Pmu_16730 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Amidohydro_1 Peptidase_M23 RnfC_N DUF2118
Motif
Other DBs
NCBI-ProteinID: AET16546
Position
1789227..1791023
Genome map
AA seq 598 aa AA seqDB search
MTTQNKKIAITDVVLRDAHQSLFATRMRLDDMLPIAHELDQIGYWSLEAWGGATFDACIR
FLGEDPWVRLRELKQAMPNTPLQMLLRGQNLLGYRHYADDVVDRFVERSVKNGMSVFRVF
DAMNDPRNMKQALQAVKRNGGHAQGTLSYTTSPVHNLETWLEITEQLLEIGVDSVVIKDM
SGILTPVEAYKLVSEIKKRYDVQLHLHCHATTGMAEMALLKAVEAGIDGIDTSISSMSGT
YGHPSTEALVATLQGTQYDTGLDIHKLEHIAAYFREVRKKYAKFEGQLRGSDSRILVAQV
PGGMLTNLESQLKQQNASDKLDEVLKEIPRVREDLGFIPLVTPTSQIVGTQAVINVLMGE
RYKTIAKETAGILKGEYGRTPAPVNAELQAKVLDGGQPITDRPADHIAPEMEKLATEIKQ
QAKEKGIKLAENEIDDVLIVALFPQIGWKFLENRGNPDAFEPAPTLETAKPAEKPAAPVA
KTPVSGPAVYTVELEGKSFVVKVTDGGEVGEIAPAAQTAPQPAPASTSGTPVSAPMSGNI
WKVVAKEGQKVAEGDVLLILEAMKMETEIRASQAGTVQSIHVKAGDTVAVGDTLMTLS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgactactcaaaacaaaaaaattgccattactgatgttgtgttacgtgacgctcatcaa
tctctctttgccacgcgtatgcgccttgatgacatgttgcctattgcacatgagttagat
caaattggctattggtcgcttgaagcctgggggggcgcgacttttgatgcgtgtattcgt
tttttaggggaagatccttgggtacgtttacgtgaattaaaacaagccatgccaaatacg
ccgttacaaatgctgttgcgcggtcaaaacctattaggttatcgtcattatgcggatgac
gtcgtggatcgctttgtagaacgctccgtgaaaaatgggatgtccgttttccgtgtcttc
gatgccatgaacgacccgcgtaatatgaaacaagccttgcaagccgtaaaacgtaacggt
ggacatgcccaagggacattaagttataccactagcccagtacataacttagaaacctgg
ttggagattactgagcaattattagaaatcggtgtcgattccgtggtgattaaagatatg
tccgggattctaaccccagtagaagcttacaaattagtcagtgaaattaaaaaacgctac
gatgttcaactccatttacattgccacgccacgacgggaatggcagaaatggcgttatta
aaagctgtagaagcgggtattgatggcattgacacctcaatttcctctatgagtggcact
tatggtcacccgtcaactgaagccttagtcgcgactttacaaggtacacaatatgacacc
ggcttagatatccataaattagaacatattgctgcctacttccgcgaagtacgtaaaaaa
tacgctaaatttgaaggtcaattacgtggttcagatagccgtatcttagttgcacaagta
ccaggtgggatgttgacgaaccttgaaagccagctcaaacaacaaaatgcgtcggataaa
ttagatgaggtattgaaagaaattccacgtgtgcgtgaagatttaggctttattccatta
gttacgcctacctcacaaattgtcggtacacaggccgtgattaacgtgttaatgggtgag
cgttataaaaccattgctaaagaaacagcgggtattttgaaaggtgagtacggtcgtaca
cctgccccggtcaatgctgaattacaagccaaagtgttagacggtgggcaacctatcact
gatcgtccagccgatcatattgcaccagaaatggaaaaattagccacagaaatcaaacaa
caagccaaagaaaaaggcattaaactggctgaaaatgaaattgatgatgtattgattgtg
gcgttattcccacaaatcggttggaaattcttggaaaatcgtggcaacccagatgccttt
gaacctgcaccaaccttagaaaccgcaaaaccggcagaaaaaccagctgcacctgtggcg
aaaacaccagtttcaggacctgccgtttacaccgtggaattagaaggcaaatcctttgta
gtgaaagtcacagacgggggagaagtcggtgagattgcccctgcagcacaaacagcgcca
caacctgccccggcatctacgagtggaacacctgtcagcgccccaatgtctggcaatatc
tggaaagtggtagcaaaagaagggcaaaaagtggcagaaggggatgtgttactcatttta
gaagccatgaaaatggaaactgaaattcgtgcaagccaagcaggtaccgtacaaagtatt
catgtaaaagccggcgatactgttgccgttggcgataccttaatgacattaagctaa

DBGET integrated database retrieval system