KEGG   Paenibacillus mucilaginosus 3016: PM3016_121Help
Entry
PM3016_121        CDS       T01757                                 

Definition
(GenBank) ArgF
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00220  Arginine biosynthesis
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01130  Biosynthesis of antibiotics
pmq01230  Biosynthesis of amino acids
Module
pmq_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PM3016_121
Enzymes [BR:pmq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     PM3016_121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Glyco_hydro_101 Root_cap
Motif
Other DBs
NCBI-ProteinID: AFC27108
UniProt: H6NTG1
Position
126971..127927
Genome map
AA seq 318 aa AA seqDB search
MAGTTEQDIEISLKGRDFIGLVDYAPEEIQYLIDLAINLKKKNQAGEVFQPLKGKTLGMI
FEKSSTRTRVSFEVGMYQLGGHALFLSKNDLQLGRGETIHDTAQTMSRYLDGIMIRTYAH
RTVIELARGATVPVINGLTDLSHPCQALADYQTIQEKKGRLQGLKMAYIGDGNNMVHSLM
MGAAKLGMNFAVATPQGYEPDSEVLELSREAASKAGSSIWVGTDPVEAIADADVVYTDVW
ASMGFEAEQKERELAFKNFQVNEALVKYAKKDYLFMHCLPAHRGEEVSEGVIDGANSVIF
DQAENRLHAQKAVMAAIM
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaacgacagagcaggatatcgagatcagcctgaaagggcgcgattttatcggt
ctggtggattatgcgccggaagagattcaatatttgatcgacctggcaatcaatctcaag
aagaagaaccaggccggggaagtgtttcaaccgctgaagggcaagaccctcggcatgatt
tttgaaaaatcatccacgcgtacgcgtgtttcctttgaagtagggatgtaccagctcggc
gggcatgcgctgttcctcagcaagaacgatctgcagctcggccgcggggagaccattcat
gataccgcccagacgatgtcgcgctatcttgacggcatcatgattcgcacctatgcgcac
cggacggtgatcgaactggcccgcggggcaacggtaccggtcattaacggtctgacggat
ctgtcgcacccgtgccaggcgctggcggactaccagacgatccaggagaagaagggccgt
ctgcaggggcttaagatggcttacatcggcgacggcaacaacatggtgcattcgctgatg
atgggcgcggcgaagctcggcatgaactttgcggtggcgacgccgcagggctacgagccg
gacagcgaagtgctcgagctgtcgagagaagcggcttccaaggccggcagctccatctgg
gtcggcaccgatccggtggaagccatcgccgatgcggatgtcgtctatacggacgtctgg
gcgagcatgggcttcgaagcggagcagaaggagcgggagctcgcgttcaagaatttccag
gtgaacgaagcgcttgtgaagtacgcgaagaaggactacctcttcatgcactgtctgcct
gcacaccgcggcgaagaagtgtccgaaggggtaatcgacggggccaactccgtgatcttc
gatcaggcggagaatcgtctgcacgcgcagaaagccgttatggccgccattatgtag

DBGET integrated database retrieval system