KEGG   Paenibacillus mucilaginosus 3016: PM3016_1754Help
Entry
PM3016_1754       CDS       T01757                                 

Definition
(GenBank) HutU
  KO
K01712  urocanate hydratase [EC:4.2.1.49]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00340  Histidine metabolism
pmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PM3016_1754
Enzymes [BR:pmq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.49  urocanate hydratase
     PM3016_1754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urocanase_C Urocanase Urocanase_N
Motif
Other DBs
NCBI-ProteinID: AFC28666
UniProt: H6NEX5
Position
1978571..1980151
Genome map
AA seq 526 aa AA seqDB search
MNNLDPEVAEHPESLVVYGGIGRAARNWACFDAIVRSLQALEENETLLIQSGKPVAVFRT
HRDAPRVLLANSNLVPAWANWEHFHELDRRGLMMYGQMTAGSWIYIGSQGIVQGTYETFA
ECARQHFGGTLQGTITVTAGLGGMGGAQPLAVTMNGGVLIGVEADRSRIEKRIATRYCDV
LAETLEAALALAQEARDAGRALSVGLVGNAAEVLPQMLAQGFVPDIVTDQTSAHDPLNGY
LPAGCSLEEAARLRAQQPQELVRRAKAGMAVHVEAMLEMQRRGAVAFDYGNNIRQAACDE
GVAEAFAIPGFVPAYIRPQFCRGRGPFRWAALSGDPEDIRRTDEAVLQLFPDDEGLHRWI
GMARQKIAFQGLPSRICWLGYGERALFGRKINDMVAAGELSAPIVIGRDHLDAGSVASPN
RETESMLDGSDAVADWPILNALLNTAAGASWVSLHHGGGVGMGYSIHAGMVVVADGTPEA
AERLERVLTTDPGMGVVRHADAGYDLAVETAKTHGIIRPMGEQTNE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacctggaccctgaggtggcggagcatcccgagtcattggtggtctacggggga
atcggccgcgcggcgaggaactgggcgtgctttgacgcgatcgtcaggagcctgcaggcg
ctggaggagaacgagacgctgctcatccagtccggcaagccggtggcggtgttccggacc
caccgggacgcgccgcgcgtgctgctggcgaattccaatctcgtgccggcctgggcgaac
tgggagcattttcacgaattggaccgcagggggctgatgatgtacggccagatgaccgct
ggcagctggatctacatcggctcgcaggggattgtgcagggcacgtacgagacattcgcg
gagtgcgccaggcagcacttcggcggcacgctgcaggggacgatcacggtgacggcagga
ctcggcgggatgggaggcgcccagccgcttgccgtgacgatgaacgggggcgtgctgatc
ggtgttgaagccgaccggtcgaggatcgagaagcggatcgcgacccgctactgcgatgtg
ctcgccgagacgctggaggcggcgcttgcgctggcgcaggaggccagggacgctggtcgt
gcgctgtcggtgggccttgtaggcaacgcggcggaggtcctgccgcagatgctcgcccag
ggctttgtgccggatatcgtcacggaccagacgtccgcccacgatccgctgaacgggtac
ctgccggccggctgctctctggaggaggcggcaaggcttcgcgcgcagcagccgcaggag
ctggtacggcgggccaaagccggcatggccgtccatgtggaggcgatgctggagatgcag
cgccgcggggcggtggccttcgactacggcaacaacatccggcaggctgcctgcgacgaa
ggggtggcggaggccttcgctatccccgggttcgtgccggcctacatccggccgcagttc
tgccggggccgggggccgttccgctgggcggcgctctcgggcgatccggaggacatccgg
cgcaccgacgaagcggtgcttcagctgttcccggacgatgaggggctgcaccgctggatc
gggatggcccgccagaagatcgccttccagggtcttccttcgaggatctgctggctcggc
tatggcgagcgggcgctttttggccggaagatcaatgacatggtcgccgcaggcgagctc
tccgccccgattgtcatcggccgcgaccatctcgatgcgggctccgtcgcttcgcccaac
cgggagacggagtcgatgcttgacggcagcgacgcggtagccgactggccgatcctgaac
gcgctgctgaacacggcggccggcgcgagctgggtgtcgctgcatcacgggggcggcgta
gggatggggtactcgatccacgccggtatggtcgtggttgccgacggcacgccggaggcg
gcggagcggctggagcgcgtcctgacgacggacccgggcatgggtgtcgtacgccatgcg
gacgcggggtacgatctggcggtggagacggcgaagacgcacggcattatcaggcctatg
ggagagcagacgaacgaatga

DBGET integrated database retrieval system