KEGG   Paenibacillus mucilaginosus 3016: PM3016_1755Help
Entry
PM3016_1755       CDS       T01757                                 

Definition
(GenBank) HutI
  KO
K01468  imidazolonepropionase [EC:3.5.2.7]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00340  Histidine metabolism
pmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    PM3016_1755
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.7  imidazolonepropionase
     PM3016_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_3 Amidohydro_1
Motif
Other DBs
NCBI-ProteinID: AFC28667
UniProt: H6NEX6
Position
1980172..1981461
Genome map
AA seq 429 aa AA seqDB search
MPTRMVYVRRAAQVVTAAGASLRPKRGAEMSELGIIEGGSVITRDDRILFAGPDEEAQRV
LAAAPEDAEVEVLEAEGKLVTPGLIDPHTHVVFAGSREFELPLRLKGAAYMDILKAGGGI
LYTAEQTRAAEEDLLAAETRRRLDRFLLHGVTTVEAKSGYGLRLEDELKQLRTARRLNAE
HPVELVSTFMGAHAVPPEYKGDPEAYVRLVIEEMIPAVAEAGLAEFCDVFCEEGVFTPEQ
SRRILEAGLARGLKPKLHADEIVPYGGAELAAAVGAVTADHLLQASGEGIAAMARRGVIA
VLLPGTAFFLRKPPADARRMISAGVPVALATDRNPGSSPTESLPLIMNLACLGMGMTPEE
VLAACTINAAHAVGRASRIGSIEAGKQADLVLFDAPNVTYLQYHFGVNLVDTVIKRGVCV
VRDGRRAGA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccgcatggtatatgtccggcgcgccgcgcaggtggtgacggccgccggggca
agcctccggccgaagcggggcgcggagatgtcggagcttgggatcatcgagggggggagc
gtgattacgcgggacgaccggatactcttcgcgggaccggatgaggaggctcagcgggtt
cttgccgcggcgccggaggatgcggaagtcgaggtgctggaggcggaggggaagctggtc
accccggggctgatcgacccgcatacgcatgtcgtgttcgcggggagccgggagttcgag
ctgccgctccgcctgaagggtgcggcctatatggacattttgaaggccggcggggggatc
ctgtacacggcggagcagacccgggcggcggaggaggacctgctggcggcggagacgcga
aggcggctggaccgcttccttctgcacggcgtgacgaccgtcgaggccaaaagcggctac
ggcctgcgcctcgaagacgagctgaagcagctgcgcacggcccgccggctgaacgccgag
catcccgtagagctcgtgtccacgttcatgggggcgcacgccgtgccgccggagtacaag
ggcgacccggaggcttacgtccggctcgtcatcgaggagatgatcccggccgtcgctgag
gcggggctcgccgagttctgcgacgtgttctgcgaggagggtgtgttcacgccggagcag
tcacggcgcatcctcgaggccggcctggcacggggcctgaagccgaagctccacgccgac
gagatcgtgccgtacggcggggccgaactggcggcggccgtaggagccgtgacggcggat
cacctgctgcaggcttcgggcgagggcattgccgccatggcccggcgcggcgtcatcgcg
gtgctgctgcccggcacggcgttcttcctgcgcaagcctccggcggatgcccggcggatg
atctcggcgggcgtgccggtggctctggctaccgaccgcaatccgggctcttcgccgacc
gagtcgctgccgctcatcatgaacctggcctgcctgggcatgggcatgacgcctgaggag
gtgctcgccgcttgcactatcaatgcggcgcacgcggtcggccgggcttcccggatcggc
agcattgaagccggcaagcaggcggatctcgtgctttttgatgcgccgaatgtcacgtac
ctgcagtatcacttcggggtgaatctcgtggatacggtgatcaagcggggcgtctgcgtt
gtgcgggacggaaggagggcgggggcatga

DBGET integrated database retrieval system