KEGG   Paenibacillus mucilaginosus 3016: PM3016_1759Help
Entry
PM3016_1759       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1453 2HCT Acyl_transf_3
Motif
Other DBs
NCBI-ProteinID: AFC28671
UniProt: H6NEY0
Position
complement(1988213..1988701)
Genome map
AA seq 162 aa AA seqDB search
MEALPVLIMIVIVGFVLRRRIRAAARPVTGRGLRLLLPLLILPLGLPGVWNPQLHLTLKE
VVLSLLFGLLMSVPMILTTNYERREDGRIYPVKSKAFIVVILALIALRLGLRSYLSALDP
AELAMLFYLIAAAYIVPWRIAGFVKFRRIQGAARQEDQGFPL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
ttggaagcacttcctgtattgatcatgatcgttattgtcggattcgtcctgcggcggaga
atccgggcggccgcccgtccggtgacgggccgggggctcagactgctgctgccccttctg
atcctgccgctcggccttcccggcgtatggaatccgcagcttcacctgaccttgaaggag
gtcgtgctgtctcttctgttcggcctgctcatgtcggtcccgatgattctgaccacgaac
tacgaacgccgggaggacggacggatctacccggtgaagagcaaagccttcattgtcgtc
atcctggccctgatcgccctgcggctcggtctgcgcagctacctgtcggccctcgatccg
gccgaactggccatgctgttctacctgatcgctgcggcctatatcgtgccctggcggatc
gccggcttcgtcaagttccgccgcatccagggagcagcccgccaggaggatcaagggttc
cccctataa

DBGET integrated database retrieval system