KEGG   Paenibacillus mucilaginosus 3016: PM3016_1762Help
Entry
PM3016_1762       CDS       T01757                                 

Definition
(GenBank) Thermophilic beta-amylase
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_14 CBM_20 Glyco_hydro_42
Motif
Other DBs
NCBI-ProteinID: AFC28674
UniProt: H6NEY3
Position
complement(1992379..1994031)
Genome map
AA seq 550 aa AA seqDB search
MAITTVSTSVLLRKSSAALLSLVVGAGLLAPIPSAEASSISSDYKAYVMAPLTKITDWNA
FRNQLITLKNNNVYAVTTDVWWGDVEGAGDNVFDWSYYKTYADTVRAAGLKWVPILSTHQ
CGGNVGDDCDIKLPNWLWSKGAQDQLTIRSETGFYNKETLSPWWSGTAAQYDELYASFAS
NFSGYKDIIAKIYLSGGPAGELRFPSYNTADGWSYPSRGKLQAYTDSAKADFRTAMQTKY
GTVGALNTAWGTSLASFSDVSPPSDGDNFFTNGYKSNYGKDFLTWYQGVLEKHVKAIGAK
AHSRFDSVFGVPVGAKISGVHWQMNNPTMPHSAEYGAGYYNYSTLLDAFKSANLDLTFTC
LEMTDAQANTAPYYSAPKSLVIQVSNLANQKGIRLNGENALAIGDAGQYQNVAEMLFNYN
FSGFTLLRMSSLVNASGTATSLMSSFRDALAMTPTAVTFVVKGAPTASGDTVYVTGSRWE
MGNWTTGVYPLKLTYNSTTADWRGTAYIGSGRNYEFKAIVKNSAGAVTWEPGSNNTLTVP
SAASTYTITW
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
ttggcaattaccaccgtttctacatccgtactgctccgcaaaagctccgccgccctgctg
tcccttgtcgtaggggccggactgctcgctccgattccttccgccgaagcatccagtatc
tccagcgattataaggcctatgtcatggcgccgctcaccaagattacggactggaatgcg
ttccgcaaccagctcatcaccctgaagaacaataatgtatacgctgtcacgaccgacgta
tggtggggtgatgtggaaggtgccggggataacgtgttcgactggtcctactacaaaact
tacgccgatacggtccgcgcggccgggctcaaatgggtgccgatcctctccacacaccaa
tgcggcggcaacgtaggcgacgactgcgatatcaagctcccgaactggctgtggagcaaa
ggagcgcaggatcagctgactatccgcagcgaaaccggtttctacaacaaggaaacgctc
tctccatggtggagcggcacggccgcccagtatgacgagctctatgcttccttcgcttcc
aacttcagcggctacaaggacatcatcgccaaaatctatctgtccggcggaccggcaggc
gagctccgcttcccgtcctacaatacggcggacggctggtcctacccgagccgcggcaag
ctgcaggcttacacggactccgccaaggccgacttccgtaccgccatgcagaccaagtac
ggcacagtaggcgccctgaatacggcgtggggaacctccctcgcttcgttctccgacgtg
agcccgccgagcgacggcgacaatttcttcacgaatggctataagtccaactacggcaag
gatttcctcacctggtaccagggtgtcctggagaagcatgtgaaggcgatcggcgccaag
gcgcacagccgcttcgactccgtgtttggcgtgccggtcggcgcgaaaatctcgggcgtg
cactggcagatgaacaacccgaccatgccgcattccgccgaatacggcgcaggctattac
aattacagcacgctgctggacgcattcaagagcgccaatctcgacctgacgttcacgtgc
ctggagatgaccgacgcccaggcgaatacggcgccttattactccgcaccgaagtctctc
gtgatccaggtgtcgaacctcgccaaccagaagggcatccgcctcaacggcgagaacgcg
ctggccatcggtgacgccggccagtaccagaacgtggccgagatgctcttcaactacaac
ttctccggcttcacgctgcttcggatgtcgagcctcgtgaatgcgagcggaacggctacc
tccttgatgagctccttccgcgatgccctggcgatgactccgactgccgttaccttcgtc
gtgaagggggctcccacagcttccggtgacaccgtctacgtaaccggctcccgctgggag
atgggcaactggacaaccggcgtttacccgctgaagcttacttacaacagcaccacagcg
gactggagaggcacagcctatatcgggtccggacggaactatgagttcaaagcgatcgtc
aagaattccgcaggcgccgttacctgggagccgggctcgaacaacacgctgaccgttcca
tcggccgcaagcacgtacacgatcacttggtaa

DBGET integrated database retrieval system