KEGG   Paenibacillus mucilaginosus 3016: PM3016_1767Help
Entry
PM3016_1767       CDS       T01757                                 

Definition
(GenBank) inner-membrane translocator
  KO
K02057  simple sugar transport system permease protein
Organism
pmq  Paenibacillus mucilaginosus 3016
Module
pmq_M00221  Putative simple sugar transport system
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmq02000]
    PM3016_1767
Transporters [BR:pmq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    PM3016_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: AFC28679
UniProt: H6NEY8
Position
1999091..1999891
Genome map
AA seq 266 aa AA seqDB search
MGAVTSCIVFIQTGSLTLALLAVLAVSAVLGLVHGVLCVTLRANQVVSGLAMTLFGTGLS
AYLGKPVSGQPLPGAVPKLDLPSLQGIPVIGPLFGHLDLFTYLSFALVLALHLFIHRTSW
GLSLRAVGDNPATADVMGIPVLGLRYACIVIGTMMIGLAGADLLLVYTPAWNEGMTAGRG
WIAVALIIFARWNPVRALVCAYFFGALDTLGLRIQLTGIEIPSYFLKMIPYLVTVAVLMF
LGWRSRGKPSGAPEALGLPYIREQRF
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggggcggtcacctcctgcatcgtgttcatccagaccggcagcctgaccctcgccctt
ctcgcggtgctcgccgtaagtgctgtgctcggcctggtgcatggcgtgctgtgcgtcacg
ctccgggcgaatcaggtcgtcagcggcctcgccatgacgctgttcggcacggggctcagc
gcctatctcggcaagcccgtgagcgggcagcccctgccgggagccgtgccgaagctggac
ctgccgtcgctgcagggcattccggtcatcggtccgctttttgggcacctggacctgttc
acgtatctcagctttgcgctggtgctggcgctgcacctttttatccaccgcacctcctgg
ggactcagtctgcgcgccgtcggcgacaatcccgctacggccgatgtcatgggcattccg
gtgctcgggctgcgctacgcctgcatcgtcatcggcacgatgatgatcgggctggcggga
gcggacctgctcctcgtctacacccctgcgtggaacgaggggatgacggccggccggggc
tggattgcggtagctctcatcatcttcgcccggtggaaccccgtgcgtgcgctggtgtgc
gcctacttcttcggcgcgctggatacgctcggcctccgcatccagctgacgggtatcgag
attccgtcttattttctcaaaatgattccgtatctcgtcacggtggccgtcctgatgttc
ctgggctggcgcagccgcggcaagccctcgggcgcaccggaggcgctcggcttgccttat
atccgggagcagcgattctaa

DBGET integrated database retrieval system