KEGG   Paenibacillus mucilaginosus 3016: PM3016_1784Help
Entry
PM3016_1784       CDS       T01757                                 

Definition
(GenBank) putative efflux system
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF CIF
Motif
Other DBs
NCBI-ProteinID: AFC28694
UniProt: H6NH16
Position
2023005..2026121
Genome map
AA seq 1038 aa AA seqDB search
MNSLTRFSMKNVAALMIIIAMLFGGGLYAAFKLKIENFPDISFPYVMVTTTYQAAPEDVM
EEITKPIEDKVGNMEDLNNMTSTSSDSMSSVILEFKQGVDVDKKKQDVESLMQELNLPSS
ANPKVSTFGFSSQPAYYLAIYAKDGMSQTELDRIYEDQIEPAFEGIAGVDHIDSVGTRET
KMDIELDADALSAYGLTPSGVTEAIQSALNNGPIGTVELSGNEKMARITADVTSVYALQE
LEITTESGAPLLLGQIAKVQAVMESEFVARLDGHPALGIQLYKTSSANAVDFSADVEGYI
EQWKTTMPGVEFKLVYDSADEVEKSIHGLVKEGIIGAVLAAVMILLFLRNLRMTLIVLVS
IPLSILVTLLLMMQLDITLNTMTLGGIFIAVGRVVDDSIVVIENIYTELQKAHERGESVI
LKATSQVAMAITSSTIATCGVFAPIGLVSGIVGEIFRPFAITLVVALMTSLVVAVTVIPM
LAKLLVLRDSKLGAGHGHDEVPKGRIMNTYERMLHWSLNNRIKTLLASLLLLVVSIAAIV
PNLAVSFVPSGTTARTMYYQLKLPYDTSMNAMDAKTKELEVMMQEAKDSQGGPLFTYIES
LVGYGGEDDQVPYKAEIYVEVSPNADPDQVRDEYKELILNELPAGSEVEPRALGGGGGIS
TTDFSYSLKGDDQDQLEQALAVIREKLETYPELSEIEDSISDSKTQVEITVDQRKARAYG
LSAAAVRQSASAWIAEQELGDIKLDNITYTTSVSLAGDDKNSLEKLGIMPLKGSSGTTVY
LNEIAKIREVEAPMSIQREAQEQLVSVTAKINSTDKSGIAARVSSELNQLELPDGVSREV
KGVSEDINESFSQLFMAMGVAVFMVYLIMVLAFGNASAPFAILFSLPLAAIGGLIGLFIS
GESLNVTSLIGFMMLIGIVVTNAIVLVDRAQQMRAEGYTVRHALLDAGMVRLRPIIMTAG
ATIVALLPLALGFSDSGGMISKGLAVVVIGGLTTSTLLTLFVVPIVYELIESMKARLARR
FSRNKGAGPDITQTSAGM
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagtttgacccggttttccatgaaaaatgtggcggccttgatgatcatcatcgcc
atgctgttcggcggcgggctgtatgcggccttcaagctgaaaatcgagaacttcccggac
atctcgttcccgtacgtaatggtgaccactacatatcaggcggcgcctgaagatgtaatg
gaggagataacgaagccgattgaggataaggtcggcaatatggaagacctcaataacatg
acatccacctcgagcgacagcatgtcctccgtgatcctcgagttcaagcaaggcgtggac
gtcgacaagaaaaagcaggacgtcgagagcctcatgcaggagctgaatcttccaagctcc
gccaatccgaaggtctccacctttgggttctcgtcgcagcccgcttattacctggccatc
tacgccaaggacggcatgagccagacggagctggaccggatctacgaagaccagatcgaa
ccggccttcgaagggattgcgggcgtcgaccatatcgactcggtcggtacgcgtgagacg
aagatggacatcgaactggacgccgacgcactgtctgcctacgggttgaccccatcgggg
gtcacggaggcgattcaaagcgccttgaataacggtccgatcggtacggtagagttgagc
ggcaacgagaaaatggcccggattaccgcggacgtgaccagcgtctatgccctgcaggag
ctggagatcacgacggagagcggcgccccattgctgctcggacagattgccaaagtgcag
gccgtgatggaatcggagttcgtggcaaggctggacggacacccggcactcggtattcag
ttgtataaaacaagctctgcgaacgcggtggatttctcggccgatgtggaggggtacatc
gagcagtggaagacgaccatgcccggcgtggaattcaagctcgtgtatgacagcgcggat
gaagtggagaaatcgatccacggtcttgtgaaggaagggattatcggcgcggtattggcc
gccgtcatgattctgctgttcctgagaaacctgcgtatgacgctgatcgttctcgtctcg
attccgctttcgattctcgtcaccctgctgctgatgatgcagctggatatcacactgaat
acgatgaccctcggcggtatattcatcgcggtaggacgggtcgttgacgatagtatcgta
gttatcgagaatatttatacagagctacagaaggcgcatgaacggggagaatcggttatt
ctgaaggccacatcgcaggtggcgatggcgattacctcctcgacgatagccacctgcggt
gtattcgcaccgatcggtctggtcagcgggattgtgggcgagattttccgtccgttcgcc
attacgcttgtcgtcgccctgatgacttccctggttgttgcggtgacggtcattcctatg
ctggccaagctgctggtgctgcgcgactccaaattgggtgcgggacacggccatgacgaa
gtgccgaagggccggatcatgaatacctacgagcgcatgctgcactggagcctgaacaac
cggatcaagacgctgctggcttccctgctgctcctggtcgtatcgattgcggccatcgtg
ccgaatctggccgtatcgttcgtcccgtcgggaacgacggcccggacgatgtattaccag
ctgaagctgccatatgatacttcgatgaatgcgatggatgcgaagaccaaggaactcgaa
gtcatgatgcaggaggcgaaggacagccagggcggaccgctgttcacttacattgagtcg
cttgtcggctacggcggcgaagacgaccaggtgccttacaaggcggagatttatgtagag
gtctccccgaacgccgatccggatcaagtcagagatgaatacaaagaacttattctcaac
gagcttccggccggttccgaagtcgaaccccgcgctttgggcggaggaggaggcatctcc
acgacggacttctcgtactcgctgaaaggggatgatcaagaccagctggagcaggccttg
gccgtcatccgcgagaagctcgaaacgtatccggagctctccgagatcgaagacagcatc
agtgattccaagacgcaggtggagatcacggtcgaccagcgcaaagccagagcctacggt
ctcagcgctgcggctgtccggcagagtgccagcgcctggattgccgagcaggagcttggc
gacatcaagctggacaacatcacctacaccaccagcgtatcccttgcgggagatgacaag
aactcgctggagaaactcggcatcatgccgctcaagggctcttccggcacaacggtatat
ctgaacgagattgccaaaatccgtgaagtcgaagctccgatgagcatccagcgggaagca
caagagcagctcgtaagtgttacggcgaagatcaattcgaccgataaaagcggcatagcc
gcccgcgtctccagtgagctgaatcaattggagctgccggatggggtttcgcgcgaagtc
aaaggggtatccgaggacattaacgagagcttctcccagctcttcatggctatgggggta
gcggtattcatggtgtacctgatcatggtcctggcgttcgggaatgccagcgcaccgttc
gcgattctcttctctctgccgcttgcggccatcggcggcctgatcggcctgttcatcagc
ggagaatcgctcaacgtgacctcgctgatcggcttcatgatgctgatcgggatcgtggtc
acgaacgcgatcgtactggttgaccgtgcgcagcagatgcgggccgaagggtataccgtc
cggcacgccctgctggatgccggcatggtccggctgcgaccgatcatcatgaccgccggc
gcgacgatcgtcgccctgctcccgctggctctcggcttctccgacagcggcggtatgatc
tccaagggcctcgccgtagtggtcatcggcggactcacgacatccacgctgctgacgctg
ttcgtcgtgccgatcgtctacgagctgatcgaatccatgaaagcccggctggcacgccgt
ttctcgagaaataagggcgccggtccggatatcacccagacttcggcaggaatgtga

DBGET integrated database retrieval system