KEGG   Paenibacillus mucilaginosus 3016: PM3016_1788Help
Entry
PM3016_1788       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: AFC28698
UniProt: H6NH20
Position
2030726..2031574
Genome map
AA seq 282 aa AA seqDB search
MDNPMKDTRMPMTSVRSGEGTEVLKDLYAYTVKIVNVVYAGSPERPGDGWVLMDAGLPGS
AEELIGEAEARFGPGARPQAILLTHGHFDHAGAVVELAQHWQVPVYAHEAELPFVTGRSR
YPDADPGVEGGLLAKIAGWFPNEPVNLEGHVHPLPADGTVPGLPGWRWIHTPGHTPGHVS
FFRDADRALVAGDAFVNVRQDKLYQVLTQMEQLSGPPRYFTPDWPSAGESVRKLAALQPR
TAVTGHGEPLAGEAFTAGLAELAAQFERVAVPDYGRYVDGKR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtggataatccgatgaaggatacgcggatgccgatgacctcggtccgcagcggggagggc
accgaggtgctgaaggatctctacgcgtacaccgtcaagatcgtgaatgtcgtctatgcc
ggttcgccggagcgtcccggggacggctgggtgctgatggacgccggacttcccgggagt
gcggaggagctgatcggcgaggccgaagcccggttcggcccaggggcccggccgcaggcc
atcctgttgactcacggccacttcgatcatgcaggcgccgtggtcgaactggcgcagcat
tggcaggtgcccgtgtacgcccacgaggccgagctgccgttcgtcacggggcgctcgcgc
tacccggatgccgatccgggcgtggagggcgggctgctggccaagatcgcgggctggttc
ccgaatgagccggtgaatctggaggggcacgtccatccgctgccggccgatggtaccgta
ccggggctgccgggctggcgctggattcacacaccgggccatacaccgggacatgtgtcg
ttcttccgcgacgcggaccgcgccctggtcgcgggagacgcgttcgttaacgtccgtcag
gacaagctgtaccaggtcctgacgcagatggagcagctcagcggaccgccgaggtatttc
actccggactggccgtccgcaggagaatcggtgcggaagctggcggcactgcagccccgc
acagccgtcacgggccacggggagccgctggccggagaggcttttacagccgggctcgcg
gagctggcggcccaattcgagcgcgtggccgttccggattacgggcgctatgttgacggg
aagcggtga

DBGET integrated database retrieval system