KEGG   Paenibacillus mucilaginosus 3016: PM3016_1795Help
Entry
PM3016_1795       CDS       T01757                                 

Definition
(GenBank) ABC transporter
  KO
K02068  putative ABC transport system ATP-binding protein
Organism
pmq  Paenibacillus mucilaginosus 3016
Module
pmq_M00211  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmq02000]
    PM3016_1795
Transporters [BR:pmq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative ABC transporter [MD:M00211] [OT]
    PM3016_1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_29 AAA_28 RsgA_GTPase AAA_22 NACHT AAA_19 zf-U1
Motif
Other DBs
NCBI-ProteinID: AFC28705
UniProt: H6NH27
Position
2039389..2040132
Genome map
AA seq 247 aa AA seqDB search
MKQGLALSSLMKQHGETGRILFSGISAEAAAGESVALLGGSGQGKSTLLRILAWLESADG
GFVAYEGRARSEWKPSDWRRRICYVAQQPVMLPGTVEDNLRTASRLHRTAFDEPLARRCM
EALGLGGLAWSKKAGDLSGGEKQRTALVRSLLLRPEVLLLDEVTASLDPGSKSAAEELLA
AWRREHGTCQIWVTHDLRQAREACSRVWLLADGALQEDRPSRAFFEEPATEAGRSFLGAA
AEGEGEA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaggactggcattatcatcattaatgaagcagcacggggagacgggcagaatc
ctgttctccggcatttcggccgaagccgccgccggggaatccgtcgcgctgctcggcggc
tccggacagggcaagagcacgctgctgcgcatcctggcctggctggaatcggccgacggg
ggcttcgtggcctatgagggccgcgcccgcagcgagtggaagccctccgattggcgccgg
cggatctgctatgtggcgcagcagcccgtcatgctccccggcacggtggaggacaacctg
cggacggccagccggctgcaccgcaccgccttcgacgagccactggcccggcgctgtatg
gaagcgctcgggctcggcggcctggcctggagcaagaaggccggcgacctgtccggcggc
gagaagcagcgcaccgctctggtgcgttccctgctcctgcggccggaggtgctgctgctc
gacgaagtgacggcttcgctcgatccggggagcaaatccgcagccgaggagctgctcgcc
gcctggcggcgggagcacggcacctgccagatctgggtgacgcacgatctgcggcaggcc
cgcgaggcgtgctcgcgggtgtggctgctggcggacggggcgctgcaggaggaccggccg
agccgcgcgttctttgaagagcctgccacggaggcggggcgaagcttccttggggcggca
gcggaaggggagggagaagcatga

DBGET integrated database retrieval system