KEGG   Paenibacillus mucilaginosus 3016: PM3016_1796Help
Entry
PM3016_1796       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
  KO
K02069  putative ABC transport system permease protein
Organism
pmq  Paenibacillus mucilaginosus 3016
Module
pmq_M00211  Putative ABC transport system
Brite
Transporters [BR:pmq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative ABC transporter [MD:M00211] [OT]
    PM3016_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0014
Motif
Other DBs
NCBI-ProteinID: AFC28706
UniProt: H6NH28
Position
2040129..2040881
Genome map
AA seq 250 aa AA seqDB search
MSNLALLCTLAFVGVTMLLSVWQKLGLERDIAVGTVRSALQLLLVGYVLQYVFGSRHPVL
VLLIVAVMIGVAAWNAGQRAKGLPGIRRRIALALAVTELLTAGLLAGLGIIEATPQYLIP
ISGITIGSAMIVSGLYLNQMKRELESSRGEIEALLSLGASERQALQDALKRSVRSSMIPT
VDGMKTVGLVQLPGMMTGMIVAGADPVEAVRYQILIMFILASAAAVTSMLLSRLSYRLWF
DREGNLRRGL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctggcgctgctgtgcacgctggctttcgtcggcgtgacgatgctgctctcc
gtctggcagaagctcggactcgagcgggacattgccgtcggcaccgtgcgttccgccctc
cagctgctgctcgtcggctatgtgctgcagtatgtgttcgggtcccggcacccggtgctc
gtgctgctgatcgtcgccgtgatgatcggtgtggcggcctggaacgcgggccagcgggcg
aaggggctgccgggcatccggcgccgcatcgccctggccctggccgtcaccgaactgctt
acggccggcctgctggccggcctcggcatcatcgaggcgacgccccagtacctgatcccg
atcagcggcattacgatcggcagcgcgatgatcgtctcgggcctctacctgaaccagatg
aagcgcgagctggagtcctcccgcggggagatcgaggcgctgctctctctgggagcctcg
gagcgccaggcactgcaggatgcgctgaagcgctccgtccgctccagcatgatcccgacc
gtcgacgggatgaagacggtggggctggtccagcttcccggcatgatgaccggaatgatt
gtggccggagccgatccggtcgaggcggtccgctaccagatcctgatcatgttcattctg
gcctccgccgccgcggtcacctccatgctgctcagccgtttgagctacaggctgtggttt
gaccgtgaggggaatctgcgccgggggctgtag

DBGET integrated database retrieval system