KEGG   Paenibacillus mucilaginosus 3016: PM3016_1798Help
Entry
PM3016_1798       CDS       T01757                                 

Definition
(GenBank) NLP/P60 family protein
  KO
K21471  peptidoglycan DL-endopeptidase CwlO [EC:3.4.-.-]
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pmq01002]
    PM3016_1798
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmq01011]
    PM3016_1798
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     PM3016_1798
Peptidases [BR:pmq01002]
 Cysteine Peptidases
  Family C40
   PM3016_1798
Peptidoglycan biosynthesis and degradation proteins [BR:pmq01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   PM3016_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NLPC_P60 Amidase_5
Motif
Other DBs
NCBI-ProteinID: AFC28708
UniProt: H6NH30
Position
2041673..2042338
Genome map
AA seq 221 aa AA seqDB search
MQSGMDARLFDQEVTEDDALLHQGDAGLDKQVPGVPPQNGTAGGGGTGPRALQETPGMAP
ARPNPAIAPQAGGYTENVLSTAAMYFGTPYEYGSDRSDPSTFDCSDYTRWSYLYALGMNL
PQDSRSQAQYVRSFSSRVYTDIHQAQRGDLLFFIGYRGGQPDAYRGASKAMGNISHCGLY
LGNGKMIHTASARTGGVRIDNVFDNHLEYRFVMGGSVLQLK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcgggatggatgcccgtctgttcgatcaggaagtaacggaagacgatgcgctt
ctgcaccagggagatgcggggctcgacaagcaggtgcccggcgttccgccgcagaacggc
actgcaggcggcggagggacggggccgcgggcccttcaggagactccggggatggctccc
gcacggcccaaccccgcgatagctcctcaggcgggcggctatacggagaatgtgctgtcc
accgcggccatgtatttcggcacaccgtacgaatacggctcggaccggtcggatccttcc
acgttcgactgctcggattatacgaggtggtcctacctgtatgcgctcgggatgaacctg
ccgcaggattcccgcagccaggcccagtacgtaagaagcttctcgagccgggtgtacacc
gacatccatcaggcacagcggggcgacctgctctttttcatcggctaccgcggcggtcag
cccgatgcatacaggggggcgtccaaggcgatggggaacatcagccactgcggtctgtat
ctgggcaacggcaaaatgattcatacggcctccgcccggaccggaggcgtgcggatcgac
aatgtattcgacaatcacctcgaataccgcttcgtgatgggcggctcggtgctccagctc
aaataa

DBGET integrated database retrieval system