KEGG   Paenibacillus mucilaginosus 3016: PM3016_1813Help
Entry
PM3016_1813       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2642
Motif
Other DBs
NCBI-ProteinID: AFC28723
UniProt: H6NH45
Position
2053343..2053573
Genome map
AA seq 76 aa AA seqDB search
MNQPYAVQPQPIFEVQPFVVQALQSLLGQTLVLETPRGSVSGALKDVKPDHVVVHGTDGN
LYFVAVCHIIWIMPVK
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaccgtatgccgtgcagccgcagccgatttttgaagtccagcccttcgtggtg
caggcgctccagtccctgcttggacagacactcgtgctcgagacaccgaggggaagcgtg
tcgggcgcgctgaaggatgtgaagccagatcacgttgtggttcatgggaccgacggcaat
ctgtacttcgtggccgtgtgtcatattatctggatcatgccggtaaagtaa

DBGET integrated database retrieval system