KEGG   Paenibacillus mucilaginosus 3016: PM3016_1816Help
Entry
PM3016_1816       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Vma12 ABC_export Oxidored_q2
Motif
Other DBs
NCBI-ProteinID: AFC28726
UniProt: H6NH48
Position
2055412..2055741
Genome map
AA seq 109 aa AA seqDB search
MTYDTLYWLILGAGFVLTGIVGVLFMLRTEKLLLSFLAGTAVNIAITGAGVWWWSSVFAG
EEQQFSRMFGLFGLGVSFVNNIVLLFFAQLIMKRKIGGDPKPEPEDYDD
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
ttgacttatgataccctctactggctgattctcggggccggctttgtactcaccgggatc
gtcggcgtactgttcatgctccggacggagaagctgcttttgtcgttcctggcgggtacg
gcggtgaatatagcgattacgggagcgggcgtctggtggtggagctcggtcttcgccggc
gaggagcagcagttctcgcggatgttcggcttgttcggcctcggcgtctcgttcgtgaac
aatatcgtgctgctgttcttcgcccagctgatcatgaagcggaagatcgggggcgatccc
aagccggaaccggaggattacgacgactga

DBGET integrated database retrieval system