KEGG   Paenibacillus mucilaginosus 3016: PM3016_1819Help
Entry
PM3016_1819       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF997
Motif
Other DBs
NCBI-ProteinID: AFC28729
UniProt: H6NH51
Position
complement(2057346..2057597)
Genome map
AA seq 83 aa AA seqDB search
MNQEQAAKWAKIRTMGKARYVMYYGVAAWGVGLTALFTGMEWLTQGTVTGQWLTIRLLVF
SVVGFILSNFKWEKNERSHRGGQ
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggaacaagcggccaaatgggccaaaatccgcacgatgggcaaggcaaggtac
gtaatgtattacggggtcgctgcgtggggcgtcggtctgacggcgctcttcaccggcatg
gaatggctgacgcagggcacggtcaccggccagtggctgacgatccgcctgctcgtcttc
agcgtcgtaggcttcattctctccaacttcaagtgggaaaagaacgaacgcagtcaccgg
ggcggtcaataa

DBGET integrated database retrieval system