KEGG   Paenibacillus mucilaginosus 3016: PM3016_1827Help
Entry
PM3016_1827       CDS       T01757                                 

Definition
(GenBank) transcriptional regulator
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_11 HTH_20 MarR HTH_5 HTH_DeoR HTH_24 HxlR TFIIE_alpha HTH_12 HTH_IclR HTH_Crp_2 MarR_2 FaeA HTH_1 GntR PadR Rrf2 HTH_9 HTH_34 Sigma70_r4_2 HTH_42 Dimerisation2 PaaX Sigma70_r4 HTH_10 LexA_DNA_bind HTH_AsnC-type HTH_29 TrmB SMC_ScpB
Motif
Other DBs
NCBI-ProteinID: AFC28735
UniProt: H6NH57
Position
2062259..2062690
Genome map
AA seq 143 aa AA seqDB search
MKTEDGSTRKVIVTMLKTKGPLSAGEMAKQLGITEMAVRRHLHTLERDQLIEAKLVRQAM
GRPAHLYSLTEHADDLFPKKYQHLAMDLLEELELTAGADKVDFLFDRRKERLSLTLPGTD
GCQGLGGPRQGTGGDPERQRLYG
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaagacggaagacggctccacacgcaaggtcatagtaacgatgcttaagaccaaggga
ccgctgagtgcaggggagatggcgaagcagctcggcattaccgagatggccgtacgccgg
catctgcacacccttgagcgggaccagcttatcgaggccaagcttgtgcggcaggccatg
gggcgtccggcccacctgtattccttgacggagcatgcggacgatctgttcccgaagaag
taccagcacctggcgatggatctgctcgaggaactggagctgacggccggtgcggacaag
gtcgattttctgttcgaccgccgcaaggaacggcttagtctcacgctaccgggaacggat
ggatgccaaggactgggcgggccgcgtcaaggaactggcggcgatccagaacgccaacgg
ctatatggttga

DBGET integrated database retrieval system