KEGG   Paenibacillus mucilaginosus 3016: PM3016_1832Help
Entry
PM3016_1832       CDS       T01757                                 

Definition
(GenBank) cell envelope-related transcriptional attenuator
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr
Motif
Other DBs
NCBI-ProteinID: AFC28740
UniProt: H6NH62
Position
complement(2065682..2067322)
Genome map
AA seq 546 aa AA seqDB search
MFPSRIKSKKRITLRSTVVCLAVLGAGAAAYAGYLFFQADKALQNMSVATPSPIKTGLLS
GEASASEATWRPMSFLLTGVDSRGGSGGSMNTDVLMLVTLNPESRKATVVSIPRDLEMKP
KEFGLSAHKANYYYAYYYNQDKNSAIPKTKELFSDMFGLPIDYMAAIDFDGFRDVVDELG
GIETYVDMDMRYVDTWDGTDINLKQGLQTLNGKQTLDFLRYRKSNRGTEESSDTARNERQ
QKVLDELLDKMTSFSGIAGWGGILEIAGKSVKTDIPADELRRFILSFQKLKPDSIEFIHL
NGRWESPYIVPKEEDLAAAIASLRAQLELPADTQTASGSGSTYSSLYKRFGIDRAVASKE
PASTANSQSLNSTKTQTANSTRTQTTTTPKTQTTNSTKTQTSSSTSTKTQTTGSTKTQTT
DSAKSPTSETTKTQTVNSTKTPATDSVKAPATNTTQTTNSTKTPATDSTKAPDATDTTGT
ESTKVPAAGTTTTTQTTEPVEQPTQSAPTQTTEPSSVPAAGSTKVQTEIKAEADAPSEPA
ATRSFR
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtttccatcgcgtatcaaatccaaaaaacgtatcacgctccgtagtactgtcgtatgc
cttgcggtcctgggagcgggagccgccgcgtatgccggatatctcttttttcaagccgac
aaggcccttcagaatatgtccgtagccactccctcgccgatcaagacgggacttctgtcc
ggcgaagcttcagccagtgaggccacctggagaccgatgagcttcctgcttaccggggtg
gacagccgcggaggcagcggtggcagcatgaataccgacgtactgatgctcgtcacgctg
aaccccgagtcgcgcaaggccacggtcgtctccattccccgggatctcgagatgaagccc
aaggagttcgggctctcggcccacaaagccaattattattacgcctactactataatcag
gacaaaaatagcgccatcccgaagaccaaagaactgttcagcgacatgttcggactgccg
atcgattatatggcggccatcgattttgacggcttccgggatgtggtcgatgagctcggg
ggaatcgaaacctatgtcgacatggatatgcgctatgtggacacgtgggacggcaccgac
atcaatctgaagcagggcctgcagacgctgaacggcaagcagacgctcgacttcctgcgc
taccgcaagtccaaccgcgggacggaggaatcctccgatacggcgcgcaacgaacggcag
cagaaggtgctggatgagctcctggacaaaatgacctccttcagcggcatcgccggatgg
ggcggaatcctggagattgccggcaagagcgtcaagacggatatcccggccgacgagctg
cggcggttcattctctccttccagaagctgaagcccgacagcatcgagttcatccacctg
aacggccgctgggagagcccgtacatcgtgccgaaggaggaagatctggccgcggcgatc
gcttccctccgggcgcagctggagcttccagccgatacccagacggcgagcggatccgga
tctacatacagctcgctctacaagcgcttcgggatcgaccgggctgtggcatcgaaggaa
ccggcatcgacagcgaattcgcagagtctgaattcgacgaagacgcagacggcgaactca
accaggactcagacgaccaccacgccgaagacgcagaccacgaactcgacgaagacacag
acttcaagttcaacttcgacgaagacacaaacgaccggttcgacgaagacgcagaccacg
gattcggccaagagcccaacctcggagaccaccaaaactcagacagtgaattccaccaag
acgccggcgacggattcggtgaaagctccggcgacgaacaccacgcagactacgaattcg
acgaagacgccggccaccgattctacgaaggctccggacgccaccgatacgacgggtacg
gagtcaacgaaggtccctgccgcgggtacgacaacaacaacgcagaccaccgagccggtg
gaacaacccacgcaatcggcaccgacgcagactaccgagccttcgtccgtaccggcagcc
gggtccacgaaggttcaaaccgaaatcaaggcggaggccgacgcgccgtccgagcctgca
gctacaagatcgttccgctga

DBGET integrated database retrieval system