KEGG   Paenibacillus mucilaginosus 3016: PM3016_1833Help
Entry
PM3016_1833       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: AFC28741
UniProt: H6NH63
Position
2067575..2068864
Genome map
AA seq 429 aa AA seqDB search
MGDYLTKGLLLLALLGCTGCSLIGQPGAYMRLPKLPAEQETLKSVIEAALPPGAALVRPS
HAVQAGAISVVDLDGDGSEEAVFYYKIKESEQLHGEIWSQSDGAWKRSDSFEGAGYELDE
LRFERITLDDTARGVNVVAAYATSEDAPKGLAVYAVEHGRAVKKFELPYTDYVIDDLNGN
DRQDLTVILHDREKRTSAAALYEYENGLRKISTLTLDGTVEGYYSMISGRVTPELRGVVL
DAAVGAHSSYTEMLIYRDGRLRRAFDPKLTSKAYTAQSEDADRDGILDVVGMEAPPGWEK
QPIALIPWIYTYSRWDGSGGFQRVLRRYWSGQDGYYFDFPAEWPPETTLEVEEGTAVRFI
AAPGSTVRLAEIRMFPIEAWNEEQTDWLPVHRTADKVLAINREAEEYRSLLHLLSEMKSE
GSAPAWAES
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactacctaaccaaagggctgcttctgctggctctgctcggctgtacaggctgc
tccctcatcggacagcccggcgcctacatgcgtctgccgaagctgccggcggagcaggag
acgctgaagtccgtaatcgaggcggccctgcctccgggggcggccctggtccgtccgagc
catgccgtacaggccggcgcgatctccgtggtcgatctggacggagacgggagcgaggaa
gcggtcttttattataaaatcaaagaaagcgagcagctccacggcgagatctggagccag
tcggacggggcctggaagcgctccgattcattcgagggggcgggctacgagctcgacgag
ctgcgcttcgaacggattacgctggatgacaccgcccgcggggtcaatgtggtcgccgcg
tatgcgacctcggaggatgccccgaaggggctcgccgtatatgcggtggagcacggccgg
gcggtgaagaagttcgagctgccgtacacggattacgtgatcgacgatctgaacggcaac
gaccgccaggatctcaccgtcatccttcatgacagggagaagcggacctccgccgctgcc
ctttatgaatatgagaacggactgcggaaaataagcacccttaccctcgacggcacggta
gaagggtattacagcatgatcagcggccgggtgacgccggagctccggggcgtcgtgctg
gacgcggccgtaggcgcccactcctcctatacggagatgctgatctacagggacggccgg
ctccggcgggccttcgatccgaagctgacctcgaaggcgtacaccgcccagagcgaggat
gcggaccgcgacggcatcctggatgtcgtcggcatggaggcgccccccgggtgggagaag
cagccgatcgcgctgatcccctggatctatacgtacagccgctgggacggcagcggcggc
ttccagcgggtgctccggcggtattggagcgggcaggacggatattacttcgatttcccg
gccgagtggccgccggagaccacgctggaggtggaggaaggaaccgccgtccggttcatt
gcggctccaggcagcacggtaaggctggccgagatccgcatgtttccgatcgaggcgtgg
aatgaggagcagaccgactggctgccggttcaccggacggccgacaaggtgctggcgatc
aaccgggaggcggaggagtaccggagcctgctgcacctgctgtccgagatgaaaagcgaa
gggagtgcgccggcatgggccgaatcttga

DBGET integrated database retrieval system