KEGG   Paenibacillus mucilaginosus 3016: PM3016_1834Help
Entry
PM3016_1834       CDS       T01757                                 

Definition
(GenBank) response regulator
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg DUF3517
Motif
Other DBs
NCBI-ProteinID: AFC28742
UniProt: H6NH64
Position
2068849..2069565
Genome map
AA seq 238 aa AA seqDB search
MGRILILEDEDSIRSFVVVNLKRQGHEVTEAVNGDEALAHLLGEPGFDIALLDVMVPGID
GFEVCRRVREVNERIGIIFLTAKVQEQDKVMGLSLGADDHVSKPFSPGELMARIQSLLRR
ISRTEQQEAEEEDGESPVQSGPFELRRGAMELLKHGERIDLTPTEFSLVSLLLSHDDRVW
TRDALLDAVWGADYVGDPKIVDVNIRRLRQKIEDQPSKPVFIETVWGSGYRFNRGERP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgggccgaatcttgatactggaagacgaagattccatccgcagcttcgttgtcgtgaat
ctgaagcgtcaggggcatgaggtgaccgaggcggtgaacggcgatgaggccctggctcat
ctgctgggcgagcccggcttcgatatcgcgctgctggatgtgatggtgcccggcatcgac
gggttcgaggtatgccgccgcgtccgggaggtcaatgagcggatcggcattatttttctt
acggcgaaggtgcaggagcaggacaaagtcatggggctctccctcggggcggacgaccat
gtcagcaagcccttcagtccgggcgagctcatggcgcgcatccagtcgctgctgcgccgc
atcagccggacggagcagcaggaggccgaggaggaagacggtgagagtccggtccagagc
gggccgttcgagctgcggcggggggcgatggagctgctgaagcatggggaacggattgac
cttacaccgacggaattctcgctggtgtcgctgcttctctcccacgatgaccgggtgtgg
acccgcgacgccctgctcgatgcggtctggggcgccgattatgtcggggacccgaagatc
gtcgacgtcaacatccgccggctgcgccagaagatcgaggaccagccgtcaaagccggtc
ttcattgagacggtgtggggcagcggataccgcttcaaccggggggaacgcccatga

DBGET integrated database retrieval system