KEGG   Paenibacillus mucilaginosus 3016: PM3016_1862Help
Entry
PM3016_1862       CDS       T01757                                 

Definition
(GenBank) gamma-D-glutamyl-L-diamino acid endopeptidase I
  KO
K01308  g-D-glutamyl-meso-diaminopimelate peptidase [EC:3.4.19.11]
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pmq01002]
    PM3016_1862
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.11  gamma-D-glutamyl-meso-diaminopimelate peptidase
     PM3016_1862
Peptidases [BR:pmq01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   PM3016_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M14 LysM
Motif
Other DBs
NCBI-ProteinID: AFC28768
UniProt: H6NJ06
Position
2097893..2098924
Genome map
AA seq 343 aa AA seqDB search
MQAGDTYAGVAARFRLTVEELTASNPEADPRRLRIGQTLIIPQAGPVSAVDCGRPYGYTE
MMEDLSLLGRMHPFLEITSLGRSVMGREIPLVRIGSGPKEVHYNASFHANEWITSLLLMR
FLEAYAGAYADGLTLQGQEVRTMLQSTTLWLVPMVNPDGVELVLRGAAPDHPYYSELLEY
NGGSCDFSGWKANIRGVDLNDQFPAHWEAERDRRDVPGPGPRDYTGAAPLTEPEAAAMAA
FTRSRPLALVMAFHTQGRELYWNYRDLEPPEAEALAERLALCSGYRAVKLTGSDAGYKDW
FIQEFRRPGFTIEAGFGVNPLPLSQFPRIYDELLPLMLEGLRL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggcgggagatacgtatgccggcgtggcggcccgcttccggctgacggtggaggag
ctgaccgcctccaacccggaggcggacccccggcggctgcggatcggacaaacactgatc
attccccaagcgggtccggtatccgcagtggactgcggaagaccctacggctatacggag
atgatggaggatctgtcgctcctcggccggatgcatcctttccttgagatcacttcccta
ggccgcagcgtcatgggccgggagatcccgctcgtgagaatcggcagcgggccgaaggaa
gtgcattataacgcctcctttcatgccaacgaatggatcacctccctgctgctgatgcgg
ttcttggaggcgtatgccggcgcttatgcggacggcctgacgctgcaggggcaggaggtt
cggacaatgctccaaagcacgaccctgtggctggtccccatggtcaatccggacggcgtg
gagctcgtgctccgcggggcggcgccggatcatccttactacagcgagctgctggagtac
aacggcggctcctgcgacttctcgggctggaaggcgaatatccggggagtcgatctcaac
gaccagttccccgcccactgggaggcggaacgcgatcggcgcgacgtgcccggaccgggt
ccgcgggattacacgggagccgcgccgctgacggagcccgaggcggccgccatggccgcg
ttcacccgcagccggccgctggctctcgtgatggccttccacacgcagggccgggagctc
tactggaattaccgggacctggagccgccggaggccgaagcgctcgcggagcggctcgcg
ctgtgcagcgggtaccgcgccgtgaagctgaccggcagcgacgccggctacaaggactgg
ttcatccaggagttccgcaggccgggcttcacgatcgaagcgggcttcggcgtcaacccg
ctgccgctgtcccagttcccgcgcatctatgacgagctgctgccgctgatgctcgaggga
ctgaggctgtaa

DBGET integrated database retrieval system