KEGG   Paenibacillus mucilaginosus 3016: PM3016_1875Help
Entry
PM3016_1875       CDS       T01757                                 

Definition
(GenBank) DinB
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DinB DinB_2
Motif
Other DBs
NCBI-ProteinID: AFC28781
UniProt: H6NJ19
Position
2109781..2110281
Genome map
AA seq 166 aa AA seqDB search
MYTTIQSFIAEYENESLATRKLLDALTDVSLSQEIAPGFRSLGPLAWHLVHKDHGLLTGA
GLSFQAPAADSETPASAASIAEAYRTVTQSILSAVREQWSDEALGETVQIFGQSWTKGLT
LYIFLKHEIHHRGQLTILMRQAGLPVAGMYGPSKEEWSAMGMAAPV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtatacgaccattcaaagcttcatcgccgaatacgagaacgagtccctggctacccgg
aagctgctcgatgctctaaccgacgtctcgctgtcccaggagatcgctcccggcttccgg
agcctcggccctctggcctggcacctggttcacaaagaccacggactgctgacaggcgcc
ggtctctcgttccaagcgccggcggcggacagtgagacgcccgcttccgccgcttccatt
gcggaggcttaccgcacggtgacccagtcgatcctaagcgcggtacgtgagcagtggagc
gacgaggcgcttggggagacggtacagatctttggacagtcctggaccaaggggctgacg
ctgtacattttcctgaagcacgaaattcatcaccggggccaactgaccatcctgatgcgc
caggccgggctgccggttgcgggcatgtacggtccgtccaaggaagaatggtcggcgatg
ggaatggccgccccggtttga

DBGET integrated database retrieval system