KEGG   Paenibacillus mucilaginosus 3016: PM3016_1885Help
Entry
PM3016_1885       CDS       T01757                                 

Definition
(GenBank) hypothetical protein
Organism
pmq  Paenibacillus mucilaginosus 3016
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LapA_dom
Motif
Other DBs
NCBI-ProteinID: AFC28789
UniProt: H6NJ27
Position
complement(2119340..2119690)
Genome map
AA seq 116 aa AA seqDB search
MKAQWILILTLLFALVTAVFAVINVDPVRVKYVFGERDIPLILVILGSVLLGGLITGFIG
LFRQFKLKRQIRLLEKKVAEYESGQAGSAPVPSSDLQLQPAGTPSSPEVPRQDTTK
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcccaatggattctgattctcactctcttattcgcactcgtcacggccgtcttc
gccgtaatcaatgtcgatcccgtccgggtgaagtatgtcttcggcgagcgggacattccg
ctcattctcgtcattctcggctcggtcctgctcggcggcctcatcaccggattcatcggt
ctgttccggcagttcaagctgaagcgccagatccgcctgctcgagaagaaggtggcggag
tatgagagcggacaagccggctcggcccctgtcccctcgtccgacctccagttgcagcct
gccggaaccccctcctcccctgaagtgccgaggcaggatacaaccaaatga

DBGET integrated database retrieval system