KEGG   Paenibacillus mucilaginosus 3016: PM3016_1886Help
Entry
PM3016_1886       CDS       T01757                                 

Definition
(GenBank) oligoendopeptidase F
  KO
K08602  oligoendopeptidase F [EC:3.4.24.-]
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
Enzymes [BR:pmq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     PM3016_1886
Peptidases [BR:pmq01002]
 Metallo Peptidases
  Family M3
   PM3016_1886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M3 Peptidase_M3_N AA_synth Peptidase_M78
Motif
Other DBs
NCBI-ProteinID: AFC28790
UniProt: H6NJ28
Position
complement(2119813..2121606)
Genome map
AA seq 597 aa AA seqDB search
MNQLPKRNDVPAEHRWNLQDLFASQEAWDAEYQKVKDALKNVGRFEGKLADPASIKEVFQ
LEDEISIHTERLYVYANMKHHEDMADPVYQALSDKSKKLSVEVGEALSFVSPEILSLSDE
VLQALVGHPDLAFYKRTLEEMIRQKQHVLGKSEEALLAQVGNLSQAPGTIYGMLNNADLK
FPKVKNEQGEEVELTHGRYIQFLESRNREVRREAFQKMYETYGKQKNTIAATLAANVTKN
IFYAKARKYPSTLEMSLFGDKIDKEVYTNLIDAVHDSLPLMHRYMELRRKLMKVDQLHMY
DLFAPLVDEYKLEISYEEAKEKVKESLEPLGPDYLKVLQEGFDNHWIDIYENEGKRNGAY
SWGAYGTHPYVLLNHKDNLNSMFTLTHEMGHALHSYLSDENQPYRYAQYTIFLAEVASTL
NEALLMDYMLKHSSDKKEKMYLLTYYMDQFRTTVFRQTMFAEFEKIIHEKAEAGESLTPQ
LFSEIYYNLNVQYYGKEMAVDKDIEMEWARIPHFYNSFYVYKYATGFSAATSFAKQILDE
GQPAVDRYLGFLKSGGSDYSLNILKKAGVDMSTPEPIKQAMSVFKDLLEQMEKLSEA
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagttacccaaacgcaatgacgttcccgccgaacaccgctggaaccttcaggac
ctgttcgcttcccaggaagcttgggatgcggagtatcagaaggtcaaggacgctttgaag
aatgtgggccgcttcgaaggcaagctggccgatccggcttcaatcaaggaagtcttccag
ctagaagatgaaatctccatacataccgaacgtctctacgtatatgccaacatgaagcat
catgaagacatggcggatcccgtatatcaggccttatccgataaatccaagaagctcagc
gtagaagtcggcgaagccctctccttcgtgtcccccgagattctgagtctctccgatgag
gtgctccaggcgctcgtcgggcatcccgatctggccttctacaagcggacccttgaggaa
atgatccgccagaagcagcacgtcctcggcaagagcgaggaagccctcctcgcgcaggtg
ggcaacctctcccaggcgccgggcacgatctacggcatgctgaacaacgcggacctgaag
ttcccgaaggtcaagaacgagcagggcgaagaggtcgagctgacccacggccggtacatc
cagttcctggagagccgcaaccgcgaggtgcgcagggaagcgttccagaagatgtacgaa
acgtacggcaagcagaagaacaccattgcggccacgcttgcggccaatgtgacgaagaat
attttttatgccaaagcccgcaagtacccttccaccctcgagatgtccctcttcggcgac
aagatcgacaaggaagtgtatacgaacctgatcgacgccgttcatgactcgctcccgctc
atgcaccgctatatggagctgcgccgcaagctgatgaaggtggaccagctgcacatgtac
gacctcttcgctcccctcgtcgacgaatacaagctcgaaatctcgtacgaagaagcgaaa
gagaaggtcaaggagagcctggagccgctcggcccggactatctcaaggtgctgcaggaa
ggcttcgacaaccactggatcgacatctacgagaacgaaggcaagcgcaacggggcttac
agctggggagcctacggcacgcacccttacgtgctgctgaaccacaaggacaacctcaac
agcatgttcaccctcacgcacgagatgggccacgcgctgcactcctatctctcggatgag
aaccagccttaccgctacgcgcagtacacgatcttcctggcggaagtcgcctcgacgctg
aacgaagcgctgctcatggactacatgctgaagcattcgagcgacaagaaagagaagatg
tacctgctcacctactacatggaccagttccgcacgacggtgttccgtcagacgatgttc
gcggaattcgagaaaatcatccatgagaaggccgaagcgggcgaatccctgacgccgcag
ctgttcagcgagatctactacaacctcaacgtccagtattacggcaaggagatggctgtg
gataaagatatcgagatggaatgggcgcgcatcccccacttctacaactcgttctatgtc
tacaaatatgcgacgggcttctcggctgcgacgtcctttgcgaagcagatcctggatgaa
ggccagcctgccgtggaccgctacctcggcttcctgaagagcggcggcagcgactactct
ctgaacatcctgaagaaggcgggcgtggatatgtcgacgccggagccgatcaagcaggcg
atgagcgtgttcaaggacctgctcgagcagatggagaagctgtcggaagcataa

DBGET integrated database retrieval system