KEGG   Paenibacillus mucilaginosus 3016: PM3016_199Help
Entry
PM3016_199        CDS       T01757                                 

Definition
(GenBank) TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00010  Glycolysis / Gluconeogenesis
pmq00051  Fructose and mannose metabolism
pmq00562  Inositol phosphate metabolism
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01120  Microbial metabolism in diverse environments
pmq01130  Biosynthesis of antibiotics
pmq01200  Carbon metabolism
pmq01230  Biosynthesis of amino acids
Module
pmq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pmq_M00002  Glycolysis, core module involving three-carbon compounds
pmq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM3016_199
   00051 Fructose and mannose metabolism
    PM3016_199
   00562 Inositol phosphate metabolism
    PM3016_199
Enzymes [BR:pmq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PM3016_199
Exosome [BR:pmq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PM3016_199
  Exosomal proteins of bladder cancer cells
   PM3016_199
  Exosomal proteins of melanoma cells
   PM3016_199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFC27180
UniProt: H6N8Q6
Position
222331..223083
Genome map
AA seq 250 aa AA seqDB search
MRKPIIAGNWKMFKTVQEAVSFVNEVKGKAEVEGVESVICSPFTNLPALVEAVKGTTLKV
GAQNLHFEDNGAYTGEISGVMLKDLGVEYVIIGHSERRAYFGETDEIVNKKVQAAFKHGL
TPIVCVGEKLEEREANQTKDVCKVQTEGAFAGLSAEQAAQVVIAYEPIWAIGTGKSSTAA
DAQDVIGYIREVVSGLYGAETAAAVRIQYGGSVKPNNIAEYMQQPDIDGALVGGASLEPA
SYIALIEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccgattattgcaggcaactggaaaatgtttaaaaccgtacaggaagccgtt
tctttcgtgaacgaagtaaaaggcaaagcggaagtggaaggcgtggagagcgtcatctgc
tccccgttcacgaatcttcctgccctggtggaagcggtgaaaggcacgacgctcaaagtc
ggcgcccagaacctccacttcgaagacaacggtgcttacacgggtgagatcagcggcgtt
atgctgaaggatctcggcgtagagtacgtcatcatcggtcactccgagcgccgggcttac
tttggcgagacggacgagatcgtgaacaagaaggtccaagcggcattcaaacacggtctg
actccgatcgtctgcgtaggcgagaagctcgaagagcgcgaagcgaaccagaccaaggac
gtatgcaaagtgcagaccgaaggcgcatttgcaggcctgagcgcagaacaggcggcacag
gtggtcatcgcctatgagccgatctgggctatcggaacaggcaaatcttctacagctgca
gacgctcaagacgtgatcggctacatccgtgaagtcgtgagcggcctgtatggcgccgag
acggctgcagcggtacgcatccagtacggcggcagcgtgaagccgaacaatattgcggaa
tacatgcagcagccggatatcgacggcgcgcttgtaggcggagcttccctggagccggcg
tcctacatcgccctgatcgagggggccaagtaa

DBGET integrated database retrieval system