KEGG   Paenibacillus mucilaginosus 3016: PM3016_2703Help
Entry
PM3016_2703       CDS       T01757                                 

Definition
(GenBank) PckA1
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00010  Glycolysis / Gluconeogenesis
pmq00020  Citrate cycle (TCA cycle)
pmq00620  Pyruvate metabolism
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01120  Microbial metabolism in diverse environments
pmq01130  Biosynthesis of antibiotics
pmq01200  Carbon metabolism
Module
pmq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM3016_2703
   00020 Citrate cycle (TCA cycle)
    PM3016_2703
   00620 Pyruvate metabolism
    PM3016_2703
Enzymes [BR:pmq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     PM3016_2703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16
Motif
Other DBs
NCBI-ProteinID: AFC29583
UniProt: H6NHI6
Position
3134001..3135572
Genome map
AA seq 523 aa AA seqDB search
MAKRSFGIIESEQVHYGLGVGELIEEALARGEGRLTSTGALSVRTGAFTGRSPKDKYIVS
EPSVREQIDWGPVNRPMTEEQFERLYLRAQDYVAGRETYIFDGYAGSDPAHRLAIRVRTE
YAWHNLFARQLFIRPANGEQGAVTPDFTVLALPGLKADPEKDGTRSETFIVISFERRIVL
IGGTEYAGEMKKSIFSVLNYLLPLQGVLPMHCSASVGGRGDTALFYGLSGTGKTTLSADP
SRRLIGDDEHGWSERGVFNFEGGCYAKCIGLSEEKEPQIWQAIRHGAVLENVAVNPFTRE
ADYSSGELTENTRAAYPIDYIPNAVPDGMAGHPEVIVFLTADASGVLPPIARLTKAQAMY
HFLSGYTSKLAGTERGVTEPEAVFSACFGAPFLPMKPEVYAQMLGSKIDRHAVRVYLVNT
GWTGGPYGTGSRMNLGHTRAMVAAALDGSIEEAGFTPDAVFGLQVPDRVAGVPDHVLQPR
STWADSSAYDAKAAELAAAFHRNFAKFGDVSEDIRAAGPVVGR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgcagttttggcataatcgaatcggagcaggtgcattacggtctcggggtg
ggcgagctgatcgaagaggcgctggcccggggagagggcagactgacttcgaccggcgcc
ctgagcgtgcgcacgggtgccttcaccggccgttcgccgaaggacaagtacattgtcagc
gagccgtccgtccgcgagcagatcgactggggtcctgtcaaccgtcccatgacggaggag
cagttcgaacggctctatctccgggcgcaggattacgtggctggtcgcgagacctacatc
ttcgacggctatgcgggcagcgatccggctcaccgtctggcgatccgcgtgcgcaccgag
tatgcctggcacaaccttttcgcgaggcagctgttcatccgtccggcgaacggggagcag
ggagcggtgacgcccgacttcacggtgctggcgctgccgggcctgaaggccgacccggag
aaggacggcacgagatccgagacgttcatcgttatctccttcgagcgccggatcgtgctc
atcggcggaacggaatatgccggtgagatgaagaagtcgatcttcagcgtcctgaactac
ctgctgccgctgcagggcgtgctgccgatgcactgctcggccagcgtgggcgggcgcgga
gatacggcgctcttctacggcctgtcgggcaccggaaagacgacgctatcggccgacccg
tcccgccgcctcatcggcgacgacgagcacggctggtcggagcgcggcgtattcaacttc
gagggcggctgctatgccaagtgcatcggtctcagtgaagagaaggagccgcagatctgg
caggcgatccgtcacggcgcggtgctggagaacgtggcggtgaacccgttcacccgcgaa
gccgactacagcagcggggagctgacggagaacactcgcgccgcttatccgatcgactac
attccgaatgccgttccggacggcatggccggccacccggaggtcatcgtcttcctgacc
gccgatgcgtccggcgtgctgccgccgatcgccaggctgacgaaggcgcaggcgatgtac
cacttcctctccggctatacctcgaagctcgcgggcacggagcgcggcgtcacggagccg
gaagccgtattctccgcctgcttcggcgccccgttcctgccgatgaagccggaagtgtac
gcgcagatgctcggcagcaagatcgaccggcatgcagtccgcgtgtatctcgtgaacaca
ggctggacgggcggtccttacggtacgggctcgcgcatgaatctggggcacacccgggcg
atggtggccgcagctcttgacggcagcatcgaagaggccggattcacgcccgatgcggta
ttcggcctgcaggttccggaccgggttgccggcgtgccggatcacgtactgcagccgcgc
agcacctgggcggacagcagtgcttacgacgccaaagcggccgagctggcggctgcgttc
caccgcaacttcgcgaagttcggtgacgtaagcgaggatatccgtgcggcaggacctgtc
gtggggagatag

DBGET integrated database retrieval system