KEGG   Paenibacillus mucilaginosus 3016: PM3016_2831Help
Entry
PM3016_2831       CDS       T01757                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00071  Fatty acid degradation
pmq00072  Synthesis and degradation of ketone bodies
pmq00280  Valine, leucine and isoleucine degradation
pmq00310  Lysine degradation
pmq00362  Benzoate degradation
pmq00380  Tryptophan metabolism
pmq00620  Pyruvate metabolism
pmq00630  Glyoxylate and dicarboxylate metabolism
pmq00640  Propanoate metabolism
pmq00650  Butanoate metabolism
pmq00900  Terpenoid backbone biosynthesis
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01120  Microbial metabolism in diverse environments
pmq01130  Biosynthesis of antibiotics
pmq01200  Carbon metabolism
pmq01212  Fatty acid metabolism
pmq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PM3016_2831
   00630 Glyoxylate and dicarboxylate metabolism
    PM3016_2831
   00640 Propanoate metabolism
    PM3016_2831
   00650 Butanoate metabolism
    PM3016_2831
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PM3016_2831
   00072 Synthesis and degradation of ketone bodies
    PM3016_2831
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PM3016_2831
   00310 Lysine degradation
    PM3016_2831
   00380 Tryptophan metabolism
    PM3016_2831
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PM3016_2831
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PM3016_2831
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PM3016_2831
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmq04147]
    PM3016_2831
Enzymes [BR:pmq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PM3016_2831
Exosome [BR:pmq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PM3016_2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2802
Motif
Other DBs
NCBI-ProteinID: AFC29707
UniProt: H6NJM7
Position
3285982..3287187
Genome map
AA seq 401 aa AA seqDB search
MNTDREAVIVSGVRTAIGSFQGSLAGISAPELGSIVVKEALQRAGIGEEHVDEVILGSVL
QAGLGQNPARQAWLKAGFGVSVPAMTVNKVCGSGLKAVMLAAQAVLLGDAEVVVAGGMEN
MSRAPYLLPGARDGLRLGDAALVDSLVRDGLWCASCDIHMGLTAENIAERYGLTREEQDA
FAAESQRRAAEAASAGRLQAEIVPVPVPQRKGPPVLFAVDEHPRAGTTAEALARLRPAFR
DGGTVTAGNASGINDGAAALVVMSAERARELGVQPLARIRGYAQAALDPAVMGLGPVDAV
RRLVQKTGVALDSVELFELNEAFAAQSLAVMRELGVPADRVNVNGGAIALGHPIGASGAR
VLVTLLHELARREARYGIAALCIGGGQGVAMLVERVEQSAG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggatcgggaagcggttattgtcagcggagtccggacggcgatcgggagcttt
cagggttccctggcgggaatctcggccccggagctcggcagcatcgtggtgaaggaggct
ctgcagcgggccggtatcggcgaggagcatgtggatgaggtgatcctcggcagtgtgctg
caggcgggactcggccagaatccggcccggcaggcctggctgaaggcgggcttcggcgtc
tcggtgccggcgatgaccgtcaataaggtgtgcggctccgggctcaaagccgtgatgctg
gcggcgcaggccgtactcctcggagacgccgaggtcgtggtggccggggggatggagaac
atgagccgggcgccttacctgctgccgggggcaagggacggcctgcggctcggcgatgcc
gcgctcgtcgactcactggtccgcgacggcctgtggtgcgcctcctgcgatattcacatg
ggcctcacggccgagaatatcgcggaacggtacgggctgacgcgggaggagcaggacgcc
ttcgcggcggagagccagcggcgggcggcggaggcggcatcggccggccggctgcaagcc
gagatcgtgccggtgcccgtgccgcagcgcaaggggccgccggtgctcttcgccgtggac
gagcacccgcgggccggcacgacggcggaggcgctcgcccggctgcgcccggcgttccgc
gacggcggcaccgtcacggccggcaacgcctcgggcatcaacgacggcgcggcggcgctc
gtcgtgatgtcggcagagcgggcgcgggagctcggcgtgcagccgctggcccgcatccgg
ggctatgcgcaggcggcgctggacccggccgtgatgggcctcgggcctgtcgacgccgtg
cgccggctcgtgcagaagacgggcgtggcgctggactcggtggagctcttcgagctcaac
gaggcgttcgccgcccagtccctggccgtcatgcgcgagctgggcgtgcccgcggaccgc
gtgaacgtcaacggcggcgccatcgccctcggccacccgatcggggctagcggagcccgc
gtgctcgtcacgctgctgcacgagctagcccggcgggaggcgcgctatggcatcgccgcg
ctgtgtatcggcggcggccagggcgttgcgatgctcgtggagcgggtggagcagagcgcg
gggtag

DBGET integrated database retrieval system