KEGG   Paenibacillus mucilaginosus 3016: PM3016_3035Help
Entry
PM3016_3035       CDS       T01757                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01130  Biosynthesis of antibiotics
pmq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PM3016_3035
Enzymes [BR:pmq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PM3016_3035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh PEP_mutase IMPDH
Motif
Other DBs
NCBI-ProteinID: AFC29903
UniProt: H6NAH8
Position
3469977..3470789
Genome map
AA seq 270 aa AA seqDB search
MFLDRIVTTKHEEVAQLQARTTIAEMEKIIAALPPTLGFERALGAGRQRSMGLIAEVKKA
SPSKGLIREDFEPVSLARAYEQAGADCISVLTDVQYFQGANEYLTRVREAVNVPLLRKDF
TIDPYQIYEARCIGADAILLIAAILTTEQMREYQQTARSIGLDVLIEVHDKEELDRVLEL
SPTMVGINNRNLRTFVTDLHTTEELIQYIPKDVTVVSESGISRSEEITYLESIGARAVLV
GEHFMRQESVGRAVDDLLGVRPEASASREL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgatcgaatcgtaacgacgaaacacgaggaagtcgcccagctccaagcgcgg
acgacgatcgccgagatggagaagatcattgcggcgctgccgccgacgcttggctttgag
cgggccctcggggcaggccgccagcgcagcatggggctcatcgccgaggtgaagaaggcc
tcgccttccaaaggcctcatccgggaagacttcgagcccgtgtcactggcccgagcttat
gaacaggccggagccgactgcatctcggtgctgaccgacgtgcagtattttcagggggcg
aacgagtacctcacgcgtgtaagggaggcggtgaacgttccgctgctgcgcaaggatttc
accatcgacccgtaccagatctatgaagcccgctgtatcggtgcggatgcgatcctgctg
attgcggcgatcctgacgacggagcagatgcgcgaatatcagcagacggcgcgcagcatc
ggacttgacgtgctgatcgaagtgcatgacaaggaagagctggaccgcgtgctggagctg
tccccgacgatggtgggcatcaacaaccggaacctgcgcactttcgtgacagatcttcat
acgaccgaagaactcattcaatatatacctaaagacgtaacggtagtcagcgagagcggc
atctcccgcagcgaagagattacatacctggagtcgatcggcgccagggccgtgcttgtc
ggcgagcacttcatgaggcaggagagcgtaggccgggcggtcgacgacctgctgggagtc
cggccggaagcttcggcttccagggagctgtaa

DBGET integrated database retrieval system