KEGG   Paenibacillus mucilaginosus 3016: PM3016_3069Help
Entry
PM3016_3069       CDS       T01757                                 

Definition
(GenBank) PiT family inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pmq  Paenibacillus mucilaginosus 3016
Brite
KEGG Orthology (KO) [BR:pmq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PM3016_3069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HemY_N
Motif
Other DBs
NCBI-ProteinID: AFC29935
UniProt: H6NAL0
Position
complement(3499555..3500550)
Genome map
AA seq 331 aa AA seqDB search
MLTTIIVIVALALLFDFINGFHDTANAIATSISTRALSPRVAVLGAAILNFVGAIFSSEV
AKTVGGSVANPATIENGMHIVIAALISAIIWNLLTWYYGIPSSSSHTLIGSLAGAVIAGA
GMGALNWDGFRSIVIILVLSPMVAFATGFIIMWIIRQLIVMSGNSSRTKLNRTFRSFQVI
SAGLLSFSHGGNDAQKAMGIIVFGLVSMGYQDTLDVPLWVKLSAATAMGLGTSIGGWRII
KTMSKKLLKIEPVNGFASDLNSSIVIQVSTHLGMPLSTTHVISSSIIGTGSVMRFHDVKW
ATVTRMIMTWVITIPISMILAYLIYKIIFSL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaactattatcgtcatcgtagcactggcgctgctctttgactttatcaacggc
tttcacgatacggccaacgctattgccacttccatttcgacccgtgctcttagcccgcgg
gttgccgtccttggtgcggccatactcaactttgtcggagccatcttctcctcggaagtg
gcaaagaccgtcggcggctcggtcgccaacccggcaaccatcgagaacggcatgcatatc
gttatcgcagccctgatctcggcgatcatctggaacctgctcacctggtattacggtatc
ccgtcatcctcatcgcacacgttgatcggctctcttgcaggtgcggtcattgcgggtgca
gggatgggcgccctcaactgggacggtttccgctcgatcgtcattattctggtgttatcc
ccgatggtcgcttttgctaccgggtttatcatcatgtggatcatccgccagctcatcgtc
atgagcgggaacagctcccggaccaagctgaaccggacgttccgcagctttcaggtcatc
tcggcgggtctcctctccttctcccacggcggcaacgacgcccagaaggcaatgggtatt
atcgtcttcggtctcgtatcgatgggatatcaggatacactcgatgtaccgctctgggtt
aaactttcagcggcaacggcgatgggtctcggaacctccatcggcggctggcgcatcatc
aagacgatgagtaagaagctcctgaagatcgagccggtcaacggcttcgcttcagacctg
aactcctccatcgtcattcaggtctctactcacctggggatgccgctgtccaccacgcac
gtcatctcgtcttctatcatcggaacaggctcggttatgcggttccatgatgtcaagtgg
gcgacggtgacccggatgatcatgacctgggtgatcactatcccgatctcgatgattctg
gcctacttgatttacaagattatcttcagtctgtag

DBGET integrated database retrieval system