KEGG   Paenibacillus mucilaginosus 3016: PM3016_5291Help
Entry
PM3016_5291       CDS       T01757                                 

Definition
(GenBank) AcsA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pmq  Paenibacillus mucilaginosus 3016
Pathway
pmq00010  Glycolysis / Gluconeogenesis
pmq00620  Pyruvate metabolism
pmq00640  Propanoate metabolism
pmq00680  Methane metabolism
pmq01100  Metabolic pathways
pmq01110  Biosynthesis of secondary metabolites
pmq01120  Microbial metabolism in diverse environments
pmq01130  Biosynthesis of antibiotics
pmq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PM3016_5291
   00620 Pyruvate metabolism
    PM3016_5291
   00640 Propanoate metabolism
    PM3016_5291
  Energy metabolism
   00680 Methane metabolism
    PM3016_5291
Enzymes [BR:pmq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PM3016_5291
Lipid biosynthesis proteins [BR:pmq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PM3016_5291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFC31996
UniProt: H6NR03
Position
complement(6320062..6321786)
Genome map
AA seq 574 aa AA seqDB search
MDQTNVESIAPVTAQSNMKNYEEERAGFRWEDVEATFSWSQTGKLNAAYEAIDRHAESSR
RDKVALYYSDDRRDEQYTYLEMKQQSNRFGNVLKGLGVGKGDRVFIFMPRTPELYFALLG
AIKVGAVVGPLFEAFMETAVRDRLEDSEAVAIVTTPSQLSRVPVDQLPHLKHVILVGEDL
TLEAGQVDFRKEMESASDELELEWLDREDGLLIHYTSGSTGKPKGVFHVHNAMLQHYYTG
RVVLDLQEDDVYWCTADPGWVTGTSYGIFAPWLNGATNVIRGGRFSPQDWYRTIERYGVT
VWYSAPTAFRMLMGAGDDAVKQFNLGSLRHVLSVGEPLNPEVVRWGLKVYNQRIHDTWWM
TETGGQLICNYPCMAIRPGSMGKPLPGIEAAIIDDSGNVLPPYRMGNLAIKTPWPSMMRK
IWKNPAKYEEYFRIQGWYISGDSAYMDEDGYFWFQGRIDDVINTAGERVGPFEVESKLVE
HPAVAEAGVIGKPDPMRGEIIKAFIALREGYTPSDELKADISRFVKEGLSAHAAPREIEF
KDKLPKTRSGKIMRRVLKAWELNLPTGDLSTIED
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggatcagacgaatgtggaaagcattgcacctgtaacggcacaatccaacatgaagaac
tatgaagaggaacgcgcgggcttccgctgggaagacgtagaggcgacattctcctggtcg
cagaccggaaagctgaacgcggcctacgaggcgatcgaccggcatgccgaatcgtcccgc
cgggacaaagtcgccctgtactacagtgatgaccgccgcgatgaacaatatacatatctc
gagatgaagcagcagtcgaaccgattcggcaacgtgctcaagggactgggtgtcggcaaa
ggggaccgggtcttcatcttcatgccccggacgccggagctttattttgcgctgctcggg
gcgatcaaagtcggagcggtggtcggtccgctgttcgaggcgttcatggaaacggccgtg
cgcgaccggctggaggacagcgaagcggtcgcgattgtcacgaccccgtcgcagctgtcc
cgtgtccctgtggatcagctgcctcatctgaagcatgtgatcctggttggcgaagacctg
acgctcgaggccggccaagtcgatttccgcaaggaaatggagagtgcttccgacgagctg
gagctggaatggctggaccgggaggacggcctgctcatccactatacgtcgggctcgaca
ggcaagccgaagggtgtcttccatgtgcataacgcgatgctgcagcactactatacgggc
cgtgtcgtgctggatctgcaggaagacgacgtgtattggtgtacggcggacccgggctgg
gtgacggggacatcgtacggcatcttcgctccttggctgaacggggcgacgaacgtcatc
cgggggggccgcttttccccgcaggactggtaccggacgattgagcgctatggcgtaacc
gtatggtacagcgcaccgacggccttccggatgctgatgggcgccggcgacgatgccgtg
aagcagttcaacctgggatcgctccgccacgtgctgagcgtaggcgagccgctcaatccg
gaagttgtccggtgggggctcaaggtctacaaccagcgtatccacgatacgtggtggatg
acggagaccggcggccagctcatctgcaactacccgtgcatggcgatccgtcccggctcg
atgggtaagccgctgccgggtatcgaggcggccatcatcgacgattcgggcaacgtgctc
ccgccgtaccgcatgggcaacctggcgatcaagacgccttggccgtccatgatgcgcaag
atctggaagaacccggcgaagtacgaagagtacttccggattcagggctggtacatttcg
ggcgactccgcttatatggacgaagacggctatttctggttccagggacggatcgatgac
gtcatcaacaccgcgggcgagcgcgtaggcccgttcgaggtcgagagcaagctcgttgag
cacccggccgtagccgaagccggtgtcatcgggaagcccgatccgatgcgcggcgagatc
atcaaagcgttcatcgccctgcgcgaaggctacacgccgtctgacgagcttaaggccgac
atctcgcgcttcgtgaaggaaggcctgtccgcccacgcggccccgcgtgagatcgagttc
aaagacaagctgccgaagacccgcagcggcaaaatcatgcgccgcgtcctcaaagcctgg
gagctgaacctccctacaggcgacctgtccacgatcgaggattaa

DBGET integrated database retrieval system