KEGG   Proteus mirabilis HI4320: PMI0705
Entry
PMI0705           CDS       T00753                                 

Symbol
pflB
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00620  Pyruvate metabolism
pmr00640  Propanoate metabolism
pmr00650  Butanoate metabolism
pmr01100  Metabolic pathways
pmr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PMI0705 (pflB)
   00640 Propanoate metabolism
    PMI0705 (pflB)
   00650 Butanoate metabolism
    PMI0705 (pflB)
Enzymes [BR:pmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     PMI0705 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: CAR41650
UniProt: B4EV98
Position
complement(770068..772350)
AA seq 760 aa
MSDLNEKFAEAWKGFSEGEWQNNVNVRDFIQKNYTPYEGDESFLAGSTKATDTLWEQVME
GIKIENRTHAPVDFDTSVASTITSHDAGYIEKDLEQIVGLQTDAPLKRAIIPFGGIRMVE
SSCHAYNRELDPELKKIFTEYRKTHNQGVFDVYTPDILKCRKSGILTGLPDAYGRGRIIG
DYRRVALYGIEFLRKDKFAQFTSLQEKLEKGEDLEMTIQLREEIAEQHAALGQIQEMAAK
YGCDISRPAQNAKEAVQWTYFGYLAAVKSQNGAAMSFGRVSTFLDIYIQRDLDAGLLTEE
QAQELIDHLVMKLRMVRFLRTPEYDELFSGDPIWATESLGGMGLDGRTLVTKNTFRFLNT
LYTMGPSPEPNMTILWSEQLPINFKKYAAKVSIDTSSIQYENDDLMRPDFNSDDYAIACC
VSPMVVGKQMQFFGARANLAKTLLYTINGGVDEKLKIQVGPKHAPIMDEVLDFDTVMNRM
DQFMDWLATQYVTALNVIHYMHDKYSYEAALMALHDRDVYRTMACGIAGLSVAADSLSAI
KYAKVSPIRDENGLAVDFNIEGEYPQFGNNDSRVDDIACDLVERFMKKIQKLHTYRNAVP
TQSILTITSNVVYGKKTGNTPDGRRAGAPFGPGANPMHGRDQKGAVASLTSVAKLPFAYA
KDGISYTFSIVPNALGKDDDVRKANLAGLMDGYFHHEADIEGGQHLNVNVMNREMLLEAM
EDPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQTM
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgtctgatttaaatgaaaaatttgctgaagcatggaaaggtttttctgaaggtgaatgg
cagaacaatgttaatgttcgtgactttattcaaaaaaactatactccatatgaaggcgac
gaatctttcctagcaggttccactaaagcaactgatacactttgggaacaagttatggaa
ggcatcaaaattgaaaaccgcactcatgcgccggttgattttgatacttctgttgcttca
actatcacttcacacgatgcgggttatatcgaaaaagatttagaacaaatcgtcggttta
cagactgatgcacctctaaaacgtgcaatcatcccattcggtgggatccgtatggttgaa
agttcttgccacgcttataaccgtgagctagatccagagctgaaaaaaatctttactgaa
tatcgtaaaacacacaaccaaggtgtattcgatgtttatactccagacatcttaaaatgc
cgtaaatcaggtatcttaactggtctgccagatgcttatggtcgtggccgtatcatcggt
gactaccgtcgtgttgcactgtacggtatcgagttcctacgtaaagacaaattcgctcaa
ttcacctctttacaagaaaaactggaaaaaggtgaagatctggaaatgactatccaactg
cgtgaagaaatcgcagagcagcacgctgcattaggtcaaatccaagaaatggctgcgaaa
tatggttgtgatatttctcgcccagctcaaaatgcgaaagaagcagtacaatggacttac
ttcggttacttagccgccgttaaatctcaaaacggcgcagcaatgtccttcggtcgtgta
tctactttcttagatatctatatccaacgtgatctcgatgcaggtctgttgactgaagaa
caagctcaggaattaattgaccacttagtcatgaaattacgtatggttcgtttcttacgt
actcctgagtatgatgaattattctctggtgacccaatctgggcaacagaatcattaggt
ggtatgggtttagatggtcgtactttggtaactaagaatactttccgtttcttaaatacc
ctgtacaccatgggtccttcaccagaaccaaacatgactatcctatggtcagaacaactg
cctattaatttcaaaaaatatgcagctaaagtctcaatcgatacttcttcaatccagtac
gaaaatgatgacttaatgcgtcctgacttcaacagtgatgactatgcaattgcatgttgt
gttagcccaatggttgtgggtaaacaaatgcagttcttcggtgctcgtgcaaacttagct
aaaaccttactgtataccatcaatggtggtgtggatgagaaactgaaaatccaagtaggt
ccaaaacacgcacctatcatggacgaagtattagactttgatactgtgatgaaccgtatg
gatcaatttatggattggttagcaactcagtatgttactgcactgaatgttatccactac
atgcacgataaatacagctatgaagcagcactgatggcacttcatgaccgtgatgtatac
cgtactatggcttgtggtatcgcaggtctatctgttgcggctgactcactgtctgctatc
aaatatgcaaaagtatcaccaatccgtgatgaaaacggtttagccgtagacttcaacatt
gaaggtgaatacccacaatttggtaacaacgattctcgtgttgatgatatcgcttgtgac
ttagttgaacgtttcatgaagaaaattcagaaactgcacacttaccgtaacgcagtgcca
actcagtcaattctgaccatcacttcaaacgttgtgtatggtaagaaaacaggtaacact
ccagacggtcgtcgtgctggcgcaccattcggaccaggtgctaacccaatgcatggccgt
gaccaaaaaggtgcagttgcttcattaacttcagttgctaaactgccatttgcttacgcg
aaagatggtatttcttataccttctctatcgtacctaacgcgttaggtaaagatgatgat
gttcgtaaagcaaaccttgcaggtctgatggatggttacttccatcatgaagcggatatc
gaaggtggccaacatctgaatgttaacgtaatgaatcgtgaaatgctgttagaagcaatg
gaagatcctgagaaatatcctcaattaactatccgtgtttctggttatgcagtccgtttc
aactcattaactaaagagcagcaacaagacgttatcactcgtacattcactcaaacaatg
taa

DBGET integrated database retrieval system