KEGG   Proteus mirabilis HI4320: PMI0590Help
Entry
PMI0590           CDS       T00753                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00010  Glycolysis / Gluconeogenesis
pmr00260  Glycine, serine and threonine metabolism
pmr00680  Methane metabolism
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01120  Microbial metabolism in diverse environments
pmr01130  Biosynthesis of antibiotics
pmr01200  Carbon metabolism
pmr01230  Biosynthesis of amino acids
Module
pmr_M00002  Glycolysis, core module involving three-carbon compounds
pmr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PMI0590 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PMI0590 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMI0590 (gpmA)
Enzymes [BR:pmr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PMI0590 (gpmA)
Membrane trafficking [BR:pmr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PMI0590 (gpmA)
Exosome [BR:pmr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PMI0590 (gpmA)
  Exosomal proteins of melanoma cells
   PMI0590 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAR41412
UniProt: B4EST0
Position
complement(636913..637665)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESVWNKENRFTGWTDVELSDKGRNEAQEAGKLLKAEGFTFDYAYTSVL
KRAIHTLWNILDEVDQQWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDDRFPGKDPRYASLTEAELPLTESLALTIDRVTPYWEEVIKPRVASGDKVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTAVPLVYEFDENMKPIKRYYLGNAEEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaactaagcttgtgctagttcgacacggtgaaagtgtatggaacaaagaaaac
cgttttacaggctggactgacgttgaattgtcagataaaggccgtaatgaagcgcaagaa
gcaggtaaactgctgaaggctgaaggttttacttttgactacgcatatacttctgtacta
aaacgtgcaatccacactctgtggaacattcttgatgaagttgatcaacaatggctgcca
gtagagaaaagctggaaactaaacgaacgtcactacggtgcattacaaggcttaaacaaa
gctgaaacagctgaaaaatacggtgacgagcaagttaaacaatggcgtcgtggttttgcg
gttaccccaccagagttaactaaagatgatgatcgcttcccaggtaaagatccacgttat
gcatctttaactgaagctgaactgccattaacagaaagcttagcgttaactatcgaccgt
gtaacaccatattgggaagaagtcattaaacctcgcgttgcttcaggtgataaagtgatt
attgccgctcacggtaactcactgcgcgctctggttaaatacctagacaatatgagtgaa
gaagaaattcttgaactgaatatcccaacagcagtacctttagtttacgaatttgatgaa
aatatgaaaccaatcaaacgttactacttaggtaatgcagaagaaatcgcagcaaaagcc
gcggctgttgctaaccaaggtaaagcaaaataa

DBGET integrated database retrieval system