KEGG   Proteus mirabilis HI4320: PMI0664Help
Entry
PMI0664           CDS       T00753                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00340  Histidine metabolism
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01230  Biosynthesis of amino acids
Module
pmr_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PMI0664 (hisD)
Enzymes [BR:pmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PMI0664 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Mut7-C
Motif
Other DBs
NCBI-ProteinID: CAR41553
UniProt: B4ET03
Position
complement(721943..723259)
Genome map
AA seq 438 aa AA seqDB search
MMKTAFNTLNFWDKCTQQQQQQLLTRPAISASASITEQVATIISQVRNDGDKALKALSQK
YDKAAPDSVLVTKTQIDVACARLNNEIKQAIAQAMSNIRRFHEAQIPKTIEVETQPGVFC
QQVSRPIDAVGLYIPGGSAPLLSTVMMLGLPARIAGCRKIILCSPPPIADEILYIAQQIG
IDEIFQVGGAQAIAAMAFGTESIPKVDKIFGPGNAYVTEAKRQVSQSLQGAAIDMPAGPS
EVLVIADADAHPAFIAADLLSQAEHGPDSQVVLLTPDEALAKAVISETQAQLTQLTRAEI
AQQALAESRVIITRDLNQCIEISNRYGPEHLIIQTNDADSLVDSITSAGSVFLGAWSPES
AGDYASGTNHVLPTYGYTATYSSLGLADFMKRMTIQKLTAQGLADLANTIEILAQAEQLT
AHKNAVTLRVNALAQGDN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaacggcgtttaatacattaaacttctgggataaatgcacccaacagcaacaa
caacagctactcactcgcccagcgatatccgcatcagcgtctattacagagcaagttgct
acgattatttctcaggtacgcaacgatggggataaagcccttaaggcactgagtcaaaaa
tatgataaagcggctcccgatagcgtattggtgacaaaaacacagattgacgtggcttgt
gcaaggctcaataacgaaatcaaacaagcaatagcgcaagccatgagcaatatacgccgt
tttcatgaagcgcaaattcctaaaaccattgaggtagaaacgcaacctggtgtattttgc
caacaagtcagtcgccctattgatgcagtaggactttatattcccggaggatcagcgcct
ttactctcaactgtgatgatgttggggctaccggcccgtattgccggttgtcgcaaaata
attttatgctctccgccaccgattgctgatgaaattttgtatattgcgcaacaaattggt
attgatgaaatattccaagtcggtggtgctcaagccattgctgcgatggcttttggtaca
gagtctatcccaaaggtagataaaattttcggcccgggaaatgcctatgtgacagaagca
aaacgccaagtcagccaatcgctacaaggtgcggctattgatatgccagccggcccttcg
gaagtattagtgattgctgatgccgatgctcatcctgcctttattgccgctgatttacta
tcacaagcagagcacggtcctgactcacaagtggtgctattaaccccagatgaagccctt
gccaaagcggtcattagcgagacgcaagcccaattaacacaattaactcgcgcagaaata
gcacaacaagccttagccgaaagtcgtgtcattatcacccgtgatctcaaccaatgtatt
gaaatcagtaatcgctatgggcctgaacacttaattattcagactaatgatgcagactca
cttgttgatagcattactagcgccggctcagtgttcttaggggcttggtctcctgaatcg
gcgggagattacgcttctggcaccaatcacgtactacctacatacggttataccgccacc
tattcgagtttaggcttagccgattttatgaagcgtatgaccatacaaaaactgactgct
caaggtttggctgatttagccaataccattgaaatattagcgcaagcagagcaattaact
gcacataaaaatgccgtcacacttcgcgttaacgccttggctcaaggagataactag

DBGET integrated database retrieval system