KEGG   Proteus mirabilis HI4320: PMI0749
Entry
PMI0749           CDS       T00753                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
pmr  Proteus mirabilis HI4320
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmr02044]
    PMI0749
Secretion system [BR:pmr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PMI0749
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAR41730
UniProt: B4ET61
Position
complement(829313..829813)
AA seq 166 aa
MSKKNLGSVAPKERINIKYTPNTGGAQAEVELPLNMLIVGDMKGKTEETPIEDRKAISVN
QNNFNSVMESAGINLNINVRNTLEESSDSELNVNLDVKSLQDFSPDSIARQVPELNKLLE
LREALVALKGPLGNVPAFRKRLQELLENQETREQLLKELDIAANQK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagtaagaaaaatctcggtagtgttgcccctaaagaaaggattaatattaaatatacg
ccaaatactggcggagctcaggctgaagtcgaacttccattgaatatgttgattgttggg
gatatgaaaggtaaaacggaagagacccccattgaagatcgcaaagcgatttcagtcaat
caaaacaacttcaattctgttatggaaagtgctggcattaatttaaatattaatgttcgc
aataccttagaagaaagcagtgattcagagcttaatgttaatcttgatgtgaaatcttta
caggatttctctcctgatagtatcgctcgccaagtgcccgaattaaataaacttctcgaa
ttgcgtgaagctttagttgcattaaaaggtcctctaggcaatgtcccagcttttagaaag
cgtcttcaagaactacttgaaaatcaagaaactcgcgaacagcttctaaaagagctcgat
attgctgctaatcaaaaataa

DBGET integrated database retrieval system