KEGG   Proteus mirabilis HI4320: PMI1118
Entry
PMI1118           CDS       T00753                                 

Definition
(GenBank) Rhs-family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PMI1118
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmr02044]
    PMI1118
Secretion system [BR:pmr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PMI1118
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C Phage_Mu_Gp45
Other DBs
NCBI-ProteinID: CAR42413
UniProt: B4ETQ0
Position
1186581..1188683
AA seq 700 aa
MLSKDPKSTPIDPASVLKDEAINQVKNRVQSKVNETLSTPTQKVAGMASAAASLTQSASA
SANRVTAHPLIHGGGFTGGQTFAENQALQAAHGALLDALGMDSLESGLVFTCTIGGLPDD
TFQVTEFNLTEGLSSLFSLSISAVSALPFIDFQRHLGLASSLTVKRDGVLIRKVNGILAG
AVQGNTDGVKTWYHFDIRPEMWVMTLNQDSRIFQHQSVPTILKTLLDEAHVKADCQFYRE
DLHPERLYTTQKRESAFDFWCRLAFEEGINFWFEEEQLFYSDEHMGMTAGIHLTYNPQAD
TDISDSTAMTWQYGEYLCVDETIHKDNNFVRPSYPLSHENKIEQGGQHSVFESYGRFQLD
DEGRPLTQVRFEQLRNGSKVGQATTNCFALMPGKIFTLSQHPHLPMNDRWQVISVSHHGV
QPLADNSGGEGTQLSNSVSFIPGTQEWRPPYRYKPTADGDEVATVVGPPGEEIYVNEYGA
VKVHFHWDRRGSADHSASCWVRVAMGWSGNGYGFSAVPRIGTQVLVSYLNGDIDRPIITG
CTYDGRNAPPIKFPENKTQTTFRSQTHKGEGFNELRFEDAGGKQEVFLHAQKDMNTRVLH
DRTTHVLHDHVEVIENNQQMQVKGARTETIDKDNSETVGQHKKITVGKTLSINVGEVIEL
RCGASVLRMDNGGHVTINGQEFKFEATGPVKITGKDIDLN
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgcttagcaaagatccgaaatcaacgcccattgacccggcatccgttttaaaagatgaa
gccatcaatcaagtgaaaaatagggtgcaatccaaagtgaacgaaacgctatcgacaccc
acgcaaaaggtggccgggatggcctcagcagcggcctcgctcactcaatcagccagcgca
tcggccaatcgcgtgacggctcatcccctgatccacggtggcggttttaccggtggacaa
acgttcgctgaaaaccaagcactccaagcggcccatggggcgttacttgatgcattaggc
atggacagcctcgaaagtggtttggtgttcacttgcaccattggtggattgcctgacgac
acctttcaagtcaccgaatttaatcttaccgaaggattatcctcgctattttcactgtcc
atcagtgcggtcagtgccttaccctttatcgatttccagcgccatcttggcttagcctca
tcattaacggtcaaacgcgatggggtgttgatccgcaaagtcaacggtatcttagctggg
gcagtacaaggcaataccgacggagtgaaaacgtggtatcacttcgatattcgccctgaa
atgtgggtgatgaccctcaatcaagacagccgtatttttcaacatcaatcggtgccgacc
atcttaaaaaccttattggatgaggcccatgttaaagcggattgccaattctaccgtgaa
gatctacaccctgaacgtctctacaccacccaaaaacgcgaatccgcatttgatttttgg
tgtcgactggcgtttgaagagggcattaacttctggtttgaagaagaacaactgttttac
agcgatgaacatatggggatgacggcgggtattcacctcacctataacccgcaggccgac
accgatatcagcgatagcactgccatgacttggcaatatggcgaatatttgtgtgtggat
gaaactatccataaagacaacaactttgttcgtccttcttatccgttgtctcatgaaaac
aaaattgagcagggaggacagcacagtgtgtttgaaagttatggtcgttttcaattagac
gatgaaggtcgccccctaacacaggtgcgctttgagcaattacgtaacggcagcaaagtg
gggcaagcgacaacaaactgttttgcgctgatgcccggcaaaatcttcaccttatctcag
catccccatctgccgatgaatgatcgctggcaagtgatcagcgtcagccatcatggtgta
cagccattggcggacaatagcgggggcgaaggcacacaactgtcgaatagtgtctccttt
attccgggcacgcaagagtggcgtcccccttatcgttataaaccgacggccgacggcgat
gaagtggcgacggtggtgggaccgccgggggaagaaatctacgtcaatgaatatggcgcc
gtgaaagtgcattttcattgggatcgtcggggaagtgccgatcacagtgcttcatgctgg
gtgcgggttgccatgggttggagtggaaatggctatggtttttctgcggtaccgcgcatc
ggcacacaagtgttggtcagttacctgaatggggatattgacagaccgataattaccggt
tgtacctatgatggtcgtaacgcaccaccgattaagttcccagagaataagacacaaact
actttccgtagccaaacccacaaaggggaaggttttaatgaattgcgttttgaagatgcg
ggcggtaagcaagaggtgtttcttcatgcgcagaaggatatgaatacccgtgttcttcat
gatcgcactacccatgttttacacgatcatgttgaagtgatcgaaaacaatcaacagatg
caggtgaaaggcgctcgcacagaaacgatagataaagataacagcgaaacggtaggccaa
cataaaaaaattactgtaggcaaaacattatctatcaatgtcggtgaagtcattgaatta
cgttgtggagcaagtgtgctacgaatggataatggtgggcatgtcacgattaatggtcag
gaatttaagtttgaagctacaggtcctgtgaaaattacgggtaaagatatcgatttaaac
taa

DBGET integrated database retrieval system