KEGG   Proteus mirabilis HI4320: PMI1347Help
Entry
PMI1347           CDS       T00753                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00260  Glycine, serine and threonine metabolism
pmr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01130  Biosynthesis of antibiotics
pmr01230  Biosynthesis of amino acids
Module
pmr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PMI1347 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMI1347 (trpB)
Enzymes [BR:pmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PMI1347 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAR42849
UniProt: B4EWH7
Position
1426151..1427341
Genome map
AA seq 396 aa AA seqDB search
MRKLNPYFGEFGGQYVPEILIPALDQLEQAFIDAQNDPSFQQEFQDLLKNYAGRPTALTL
CRNLTQGTRTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVATAL
ACALLNMKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGCY
ERAHYLLGTAAGPHPYPTIVREFQRMIGDEAKAQILAREGRLPDAVIACIGGGSNAIGLF
ASFIPETSVQLIGVEPAGKGIETGEHGAPLKHGKLGIYFGMKSPIMQTEEGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRADYVSVTDDEAIEAFKTLSRREGIIPALESSHALAYALKL
IAQNPDKEQLLIVNLSGRGDKDIFTVNDILAARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacttaatccctactttggtgagtttggtggtcaatatgtaccagaaatattg
atccctgcattagatcaacttgaacaagcctttattgacgcacaaaacgatccgtcattt
cagcaagagtttcaagatctactcaaaaattatgcaggtagaccaacggcactgacactc
tgtcgcaatttgacccaaggtactcgtacccgtttatatctaaaacgtgaagatttattg
catggcggtgctcataaaacaaaccaagtattaggccaagcactgctagcaaaacggatg
ggaaaaacagaaattattgcagaaacgggcgctgggcaacatggtgttgccactgcgtta
gcttgtgccctgttaaatatgaagtgccgtatttatatgggggcaaaagatgttgaacgt
caatcacccaatgtatttcgtatgcgtttaatgggtgccgaagttattccggtgcatagt
ggttcatcaacattaaaagatgcgtgtaatgaagcgttacgtgactggtctggttgctac
gagcgtgctcactacttattaggcactgcggcaggcccgcatccttatcccactattgtt
cgcgaattccagcgcatgattggggatgaagctaaagcgcaaattttagcccgtgaaggt
cgtctccctgatgccgttatcgcctgtattggcggtggctctaacgccattggcttattc
gcctcatttataccagaaacctcagtacaattaattggtgttgagccggcaggaaaaggg
atcgaaacaggagagcacggagcaccattaaaacatggcaagttaggcatttatttcggt
atgaaatcaccgattatgcaaaccgaagaaggccaaattgaagagtcctattctatttct
gcaggattagatttcccatccgtaggcccgcaacatgcgcatttaaacagcattggccgt
gcagattatgtttctgtaacagatgatgaagccattgaggcttttaaaacgctatcacgc
cgtgaagggatcatccccgcattagaatcgtcacatgctctggcctatgcgttgaaactg
attgcccaaaatccagataaagaacaactcttaattgtcaatttatccggacgaggtgac
aaagatatttttactgttaacgatattttagctgcacgaggagaaatttaa

DBGET integrated database retrieval system