KEGG   Proteus mirabilis HI4320: PMI2468Help
Entry
PMI2468           CDS       T00753                                 

Definition
(GenBank) putative plasmid-related protein
  KO
K12066  conjugal transfer pilus assembly protein TraK
Organism
pmr  Proteus mirabilis HI4320
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmr02044]
    PMI2468
Secretion system [BR:pmr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PMI2468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraK
Motif
Other DBs
NCBI-ProteinID: CAR44868
UniProt: B4EWT5
Position
complement(2696730..2697629)
Genome map
AA seq 299 aa AA seqDB search
MMRTKISRWMTPSLIAISLSGVLLSQASYADVELPIVPASVMKQSATANPPTQTNTASTD
VPTTLLMTPGINELIPVALGHLNRIVTPFESPQVRTTSDAQTQIKGNVVYVATDKESPVS
LYITPPGQEAPALSVTLVPRRIPPREITLAIDGQQWPIKGVVNRKAATWETAQPYVDNLR
DLLRRLALNELPQGYDIRLAGQTDTSPKCFQPGLKFGFKQGQIVSGHYFTVYVGLVESFA
DEPIEASELACHAPDIVASAYWPRNILLPGEKTELYVVVRNHREEAVESQRPSLLVGGE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgaaccaaaattagtcgatggatgacaccaagcttaatcgcaattagcttgagt
ggcgtcctgttatcacaagcgtcgtatgcagacgtggaattgccgattgtgccagccagt
gtgatgaagcagtctgctactgcaaatccaccgactcaaaccaatacggcttcaacggat
gtgccaacaacgctgctgatgacaccggggattaatgaactgatccctgtagcacttggc
catctgaaccggattgtgacgccgtttgaatcgcctcaggtaagaacaaccagtgatgct
cagacgcaaatcaaggggaatgttgtatatgtggccacggacaaagaatcaccggtttca
ctttacatcactccgcctggtcaggaagcgcccgcattatcagtcaccttagtacctcgt
cgtattccaccgcgtgaaatcaccttagctattgatggtcagcagtggcctattaagggc
gtcgtgaaccgaaaagccgccacttgggaaacggctcagccatacgtcgataacctacgt
gacttactcagacgccttgcactaaatgagttaccacaaggctatgacatccgtttagct
ggccaaactgacacaagcccgaaatgttttcagccgggcttaaagtttggttttaagcag
gggcaaattgtgtcgggacattacttcaccgtctatgtaggactggttgaaagctttgcc
gatgagccgatagaagccagtgaattagcctgtcatgcaccagatatagtggcaagtgct
tactggccacgcaatatcttgttgccgggtgaaaagactgagttgtatgtggttgttcgc
aatcatcgtgaagaagcggtggaaagtcagcgaccttcgcttcttgtgggaggtgaataa

DBGET integrated database retrieval system