KEGG   Proteus mirabilis HI4320: PMI2470
Entry
PMI2470           CDS       T00753                                 

Definition
(GenBank) putative plasmid pilus assembly protein
  KO
K12068  conjugal transfer pilus assembly protein TraL
Organism
pmr  Proteus mirabilis HI4320
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmr02044]
    PMI2470
Secretion system [BR:pmr02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PMI2470
SSDB
Motif
Pfam: TraL DUF3487
Other DBs
NCBI-ProteinID: CAR44872
UniProt: B4EWT7
Position
complement(2698233..2698514)
AA seq 93 aa
MEPVSIPSYIDDPPHFLLWSADEMAPILLGLVIGIFTGNALVLCLLGLVTTKLYRRFRDG
RPDGFILHAIYWAGLLPTKAKTIPNPFIRSYLP
NT seq 282 nt   +upstreamnt  +downstreamnt
atggaacctgtgagtattccgtcctatatcgatgacccgccgcacttcctgctttggagt
gccgatgagatggctcccattctgttggggctagtgatcggcatttttaccggtaatgcc
ttggttttatgcctgttggggttggtgacaaccaagctctatcggcgttttcgtgatggt
cgcccagatggttttattcttcacgccatctactgggccgggctgttgccaaccaaagcc
aagacaatccctaacccatttatcaggagctatctgccgtga

DBGET integrated database retrieval system