KEGG   Proteus mirabilis HI4320: PMI2488Help
Entry
PMI2488           CDS       T00753                                 

Definition
(GenBank) putative plasmid-related protein
  KO
K18640  plasmid segregation protein ParM
Organism
pmr  Proteus mirabilis HI4320
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pmr04812]
    PMI2488
Cytoskeleton proteins [BR:pmr04812]
 Prokaryotic cytoskeleton proteins
  Actin homologs
   Actins
    PMI2488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAR44918
UniProt: B4EWV6
Position
2727430..2728404
Genome map
AA seq 324 aa AA seqDB search
MFVLGVDIGYSNLKLAIGQSGNEPKTIILPAGAGPADRMPERIGGGDDETCLYVSVDNER
WAAGVPAGRLQGWERELHPEYPTTKTYKALFHAALLMAETESIDLVVTGLPVSQFHEPQR
KSDLVQRLKGVHQVTPKRSITVHDVKVLPQPAGAYMDLVQTGGDLGLIEEGRVVVIDPGF
FSVDWVALEAGEIRYSSSGTSLQAMSVLLETIDKLISEDHGAKVGMDRLEKAMRTGDLQV
LLFGEKVDISPYLNAAMKKVAPVALTAMRQSMRDESINADLVLIAGGGALAYKEAAKEIF
SRSKIIVPEQSVLANVRGFWFYGA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtactaggcgtagatatcggttactcaaacctgaagctggcaattggccaatca
ggcaatgaaccgaaaaccattattctgcctgcgggtgccggtcctgcggatcgtatgccg
gagcgtatcggtggaggcgatgatgaaacttgtttgtatgtgtctgtcgataatgagcgt
tgggccgctggtgtgcctgctggacgccttcaaggctgggaacgagagcttcacccggaa
tatcccaccacaaaaacctataaggcgctttttcatgccgccttgttaatggctgaaaca
gaatccatcgatttggttgtcactggattaccggtttcccagtttcatgaaccacaacgt
aagtctgaccttgtgcagcgtttaaaaggtgtccatcaagtgacgccaaagcgcagcatc
accgttcatgacgtcaaagtgctgccgcagcctgccggtgcctatatggatctggttcaa
acaggtggtgatttgggcttgattgaagaaggtcgcgtcgtcgtcatagatcccggcttc
ttttctgttgactgggttgcccttgaggccggagaaattcgctacagctcatcaggaacc
agtcttcaggcaatgtccgtgctactggaaactattgataagctgatttcggaagatcac
ggtgccaaagtaggtatggatcgacttgaaaaagccatgagaaccggcgacttgcaggtc
ctgctatttggagaaaaagtcgatatttcaccttatctgaatgctgccatgaaaaaggta
gcgccagttgctcttacagccatgcgccaatctatgcgcgacgaaagcattaatgcggac
ttggtattgatcgccggaggtggagccttggcttataaggaagcggccaaggagattttt
tcacgaagcaagattatcgtgccggaacagtctgttttggcgaatgtccgaggcttctgg
ttttatggggcatga

DBGET integrated database retrieval system