KEGG   Proteus mirabilis HI4320: PMI2576
Entry
PMI2576           CDS       T00753                                 
Name
(GenBank) conserved hypothetical protein
Organism
pmr  Proteus mirabilis HI4320
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_29 AAA_22
Other DBs
NCBI-ProteinID: CAR45094
UniProt: B4EXH5
Position
complement(2814285..2817152)
AA seq 955 aa
MGFSLFRSRRKAQAVSAEKTDENKADKTVHRSTPAENAGLGRQPLSRPGKMTRADEQKIY
HANPSFIDYLPWVEFLDEEQCLLLDDGVSVGAVYAVEPAPTEGRSAGRLLEIRDAVEDAL
QDSLDEHDDNPWVVQFFCQDEDDVSVTLATLRDYILPAARGTAFTEAWLTEMARHLRGIA
RPEGLFKDTEVTGQPWRGQQRRTRMVVYRRLGNSYTDPMPPVAMLNQMCDRLVSSLGSAG
VQCVRQDGRQVHQWLLRHFNPAPDWVDRETLYREGAYWPAAEEAPGTLPVLKDFAETLWF
TPPRSDVENGVWWFDNLAHGVVNIEKLRKAPGPGHLTGEQKRGDKNINALMDLFPEGTML
SMTIVTQPQDTLEQEFTRLGKNSVGENTDSQRTRRDVETARGLLGHRHKLYRASLSLLLR
AGSVEELNKKRVDLTATLLNAGLEPVKPEYDVAPLNGYLRALPMCFDPQTDKKHWYTRLT
WVQHLAGLLPVTGRTSGTGHPGWSFFNRGGGVLTFDPQNKQDRTQNAHLLLFGPTGAGKS
ATLCAQLSQLMAVRRPRLFIAEAGNSFGLLADYYASLGLSVNKVSVKPGSGVRLPLFADA
HQLLMMDEQRLALNADELPETDSESEDDDGQRDILGEMEISARMMITGGDVREEAELKRA
DRAMIRRALMAGARASYAADRQMLPADLQEALYALSRGEGEEEGRALNPQRRAKAAEMAE
SLGMFTEPGSFEHELFNLPGELWPEADVTLIDLGHLAREGYEAQMALTMVSLINSINNIA
ERDQYRARDINFVVDEAHIVTVNPLLSPYVTKVVKMWRKLGAWLWLATQNLDDYPDCAEK
MLNMAEWWVCLTMPQKEVEAIARFKTLSEEQKQVLLSAAKLSGCYTEGVVLARKVEALFR
VVQPSLYLALGMTEKEEKQQRRVLMEQYGCSELEAAFRVADELDRKRGLPPRVPG
NT seq 2868 nt   +upstreamnt  +downstreamnt
atgggattttcattattccgctcacgccggaaagcgcaggcggtttctgctgaaaaaacg
gatgaaaacaaggctgacaaaaccgtacaccgcagtacaccggcagagaatgccggttta
ggccgtcagccgctttcccggccgggaaaaatgacccgggcggatgagcagaagatttac
catgcgaatccgtcctttattgattacctgccctgggtggaatttctggatgaggagcaa
tgcctgctgcttgatgacggggtgtcggtcggggcggtgtatgccgttgagccggcgccg
acggaagggcgctctgccggccgtctgctcgaaatccgggatgcggtggaggatgcgctt
caggacagtctggatgagcatgatgataacccgtgggtggtgcagtttttttgtcaggat
gaggacgacgtgagcgtcacactggccacattgcgggactatatcctgccggcggcccgg
ggcaccgcgtttaccgaagcctggctgaccgaaatggcgcgtcatttacgggggattgcc
cgtccggaagggctgtttaaggacacggaggtgaccggacaaccctggcgcggacagcag
cgccggacccggatggtggtttaccgccggctggggaacagctataccgatccgatgccg
ccggtggcgatgctcaatcagatgtgtgaccggctggtcagcagtctgggcagtgccggc
gtgcagtgtgtccgccaggacgggaggcaggtgcatcagtggctgctgcgtcatttcaat
ccggcccctgactgggtggaccgggagacgctgtaccgggaaggggcgtactggccggcg
gcggaggaagccccgggcaccctgccggtgctgaaggattttgcggaaacgctgtggttt
accccgccccggtcggatgtggaaaacggcgtgtggtggtttgataacctggcgcacggt
gtggtgaatatcgaaaaactgcgtaaagccccggggccggggcacctgaccggggagcag
aagcgcggtgacaaaaatatcaatgcgctgatggacctgtttccggaagggacgatgctg
tcgatgaccatcgtcacacagcctcaggatacgctggagcaggaatttacccggctgggg
aaaaactcggtgggggaaaacaccgactcgcaacgtacccgccgggacgtggaaaccgcc
agaggtttactggggcaccgccataagctttaccgggcctccctgtcattgctgctgcgt
gccggctcggtggaggaactgaacaaaaagcgcgtggatctgacggccacgctgctgaat
gccggtctggagccggtgaagccggaatatgatgtggcgccgctgaacgggtatctgcgt
gccctgccgatgtgttttgacccgcagacggataaaaaacactggtatacccggctgacc
tgggtacagcacctggccggattactgccggtgaccgggcgcaccagcggcaccgggcat
cccggctggagtttctttaaccggggcggcggggtgctgacctttgatccgcagaataaa
caggatcgtacccagaatgcgcatctgctgttattcggtcccaccggggccggtaaatcc
gccaccttatgcgcacagttatcgcagctgatggcggtccgccgtccgcgtctgtttatt
gcggaggccggtaactcctttggtttactggcggactattacgccagtctggggctgagt
gtcaataaggtcagtgtcaagcccggcagcggggtgcgtctgccgctgtttgcggatgcg
catcagctgctgatgatggatgaacagcgtctggcactgaatgcggatgaactgccagag
acggacagtgaatctgaggatgatgacgggcagcgtgacattctgggggaaatggaaatc
tccgcccgcatgatgatcaccggcggggatgtgcgggaagaagcggagctgaagcgggct
gaccgggcgatgatccgccgggcgctgatggcgggggcccgggcgtcttatgccgccgac
cggcagatgctgccggcggatttgcaggaggcgctgtatgccctctcccggggggaaggt
gaagaggaagggcgggcattaaatccgcagcgccgggcgaaagcggccgaaatggcggaa
tccctggggatgtttaccgaaccgggcagttttgagcatgagctgtttaatctgccgggg
gagctgtggccggaggcggatgtgaccctgattgatttggggcacctggcgcgggaaggg
tatgaggcccagatggcgctgacgatggtgagtcttatcaactccatcaacaatattgcc
gagcgggatcagtaccgggcccgggacattaattttgtggtggatgaggcgcatatcgtg
acggtcaacccgctgttatccccctatgtgaccaaagtggtgaaaatgtggcggaaactg
ggggcctggctgtggctggcgacccagaacctcgatgactatccggactgtgccgagaaa
atgctcaatatggcggagtggtgggtgtgtctgacgatgccgcagaaagaggtggaggca
atcgcccgctttaagacgctcagtgaggagcagaaacaggtgctgctgtccgcagccaaa
ctctccggctgttacacggaaggggtggtgctggcgcggaaagtggaggcgctgttccgg
gtggtacagccgagcttatatctggcgctggggatgacggaaaaagaggagaagcagcaa
cggcgggtgctgatggagcaatacggatgcagtgagctggaagcggcgttcagggtggca
gatgaacttgaccggaaacgggggttaccgccccgggtgccgggatga

DBGET integrated database retrieval system