KEGG   Proteus mirabilis HI4320: PMI2588
Entry
PMI2588           CDS       T00753                                 
Name
(GenBank) putative plasmid transfer protein
Organism
pmr  Proteus mirabilis HI4320
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 T4SS-DNA_transf FtsK_SpoIIIE CobU
Other DBs
NCBI-ProteinID: CAR45116
UniProt: B4EXI7
Position
complement(2824071..2826218)
AA seq 715 aa
MSDRYVIEAWLRPAVELNSALVSGGAAFVCAVAPWAVALSPSVSYVTAGAFAGFSALRAH
QGFRVLRYRRNLRRLPRYQVTSAQVPVSRQRLFLGKGFQWQQKHTQRLLETQRPEVERYV
QPPAHYRLARQFELRFESRFPAVCRLLQKDSWLNPVRPLTPVGGNPVLHGVEPDEVNVTM
DLRERVGHMLVLGTTRVGKTRLAEVLITQDIRRGNITIVFDPKGDADLLRRMWAEAHRAG
RSEEFYVFHLGWPDISARYNAIGRFGRVSEVAGRVAGQLSGEGNSAAFREFAWRFVNIIA
RALVALGERPDYAKILRYVTNIGELYQTYSMQVIKAQLPDLFAQIENAQNALTVEDVPRH
LQSDPKAVAIWATELALSSEKGKKIYDPILDGLRSAIRYDRTYFDKIVASLLPLLEKLTT
GKTAALLSPDYTNMQDPRPIFDWQQVIRKKGIVYVGLDALSDAEVAAAVGNSMFADLVSV
AGHIYKFGTQDGLPEDEHAGKLPISLHCDEFNELMGDEFIPLLNKSGGAGIEVTAYTQTW
SDIEARLGNAAKSAQVTGNFNTLVMLRVRELMTAKLLTEQLPEVDIYTKTLVSGITDISN
PRQGSDFTSNTQDRVSMVAKPLLLPADIIQLPKGQAFALLEGGKLWKIRMPLPAAEADAL
MPPDLQKIAQYMEKNYRTGETWWTASSFSDARHDSGGMNVAEMAPDTEGGNDGNC
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgagtgatcgttatgtgatagaggcctggctgcgaccggccgtggaattgaacagtgct
ctggtgtccggcggggcggcgtttgtgtgtgcggtagcgccctgggcagtggcattgtct
ccgtccgtgagttatgtcaccgccggtgcgtttgccggtttttccgcattgcgggcacat
cagggattccgggtattacgttaccgccggaatctccggcgtctgccccgctatcaggtg
acgtcggcacaggtgccggtcagccggcagcgtctgtttctgggaaaagggtttcagtgg
cagcaaaaacacacgcaacgcctgctggaaacccagcgtccggaagtggagcggtatgtt
cagccgccggcacattaccggctggcccggcagtttgaactccgttttgaatcccgtttt
ccggcggtttgccggcttttgcaaaaagacagttggctgaatccggtccgcccgctgacg
ccggtgggggggaatccggtgttacacggtgtggagccggatgaggtgaatgtgaccatg
gatttgcgtgaacgggttggtcatatgctggtactggggaccacccgtgtcggcaaaacc
cgtctggcggaagtgctgatcactcaggatatccgccgggggaatatcacgattgttttt
gatccgaaaggggatgcggatttattgcgccggatgtgggcggaagcgcatcgtgcgggg
cgcagtgaggagttttatgtttttcacttgggctggcctgatatcagtgcccgttataac
gccatcgggcgttttggccgagtatcggaagtcgcggggcgggttgccggccagttatcc
ggggaagggaacagcgcggcgttccgggagtttgcctggcggtttgttaatatcattgcc
cgggcactggttgctctgggggagcgtccggattatgccaaaattttacgttatgtcacc
aatatcggggaactctatcagacatattcgatgcaggtgattaaagcacaactacctgat
ttgtttgcccaaatcgagaatgcgcagaacgcgctgacggtcgaggatgtgccccgtcat
ctgcaaagtgatccgaaagctgtggctatctgggcaacggagctggcgttaagtagtgag
aaagggaaaaaaatctatgatccgattttggacgggctgcgcagtgcgatccgttatgac
cggacctattttgataaaatagtggcttctctgctgccgttactggaaaaactgactacc
ggaaaaactgccgccctgttgtcgccggattacaccaatatgcaggatccccgtccgatt
tttgactggcagcaggtgattcggaaaaaagggattgtatatgtcgggctggatgcgtta
tcggatgcggaagtggcggcagcggtggggaattccatgtttgcggatttggtctcggta
gccgggcatatttataaattcgggactcaggatggactgccggaggatgagcacgccgga
aaattaccgatcagcctgcattgcgatgaatttaatgaactgatgggggatgaatttatt
ccgttactgaacaagagcggcggcgcggggattgaagtgacggcctacacacagacctgg
tctgatattgaagcccggctggggaatgcggcgaaatcggcgcaggtcaccggtaacttt
aatacgctggtgatgttgcgtgtccgtgaactgatgaccgcgaaattactgacggaacag
ttaccggaagtggatatttacaccaaaaccctggtatccgggatcaccgatatttccaat
ccgaggcaggggagtgattttacctccaatacccaggacagggtcagtatggtggctaaa
ccgctgctgttaccggcagatattattcagttaccgaaaggacaggcgtttgcgctgctg
gaaggcgggaagttatggaaaatcaggatgcccctgccggcggcagaggctgatgccctg
atgccaccggatttacaaaaaatcgcacagtatatggagaaaaattaccgtaccggcgaa
acttggtggactgcgtcatcattttcggatgcgcggcatgacagcggcggtatgaatgtg
gctgagatggcaccggataccgaagggggcaacgatggcaactgctga

DBGET integrated database retrieval system