KEGG   Proteus mirabilis HI4320: PMI2764Help
Entry
PMI2764           CDS       T00753                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00620  Pyruvate metabolism
pmr00630  Glyoxylate and dicarboxylate metabolism
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01120  Microbial metabolism in diverse environments
pmr01200  Carbon metabolism
Module
pmr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PMI2764 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    PMI2764 (aceB)
Enzymes [BR:pmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PMI2764 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CAR45454
UniProt: B4EYS8
Position
complement(3027196..3028788)
Genome map
AA seq 530 aa AA seqDB search
MSQSLTTEALSFTKPFGIAEKEILNHDVESFLTNLVSQFSERRDTLLAEREIWKQKVDNG
MLPDFISESDSIINSEWKVNPIPKDLQDRRVEITGPVDRKMVINALNANVKVFMADFEDS
LAPTWDKVIDGQINLRDAVKGTISYTNEQGKCYQLKASPAVLIARVRGLHLPEKHVLWQG
KPIPGCLFDFALYFYHNYKTLQAKGSGPYFYIPKLQTWQEAKWWSDVFHFTEKRFGLASG
TIKATVLIETLPAVFQMEEILFHMKEHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQGI
TMTQPFLSAYSRLLIQTCHKRGAFAMGGMSAFIPSRSAEQNGVILQKVFEDKELEATNGH
DGTWIAHPGLAETVLSAFDAVLGERANQLDVQRHEKITAEMLLAPCEGERTATGMRANIR
VAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIRHQKPLSDGQIVTKALFRNML
KEELEVIRQEVGDTRFEQGRFKEAATLMDNITTQDELVDFLTLPGYQLLN
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcattaactacagaagcattaagcttcacaaaaccttttgggatagctgaa
aaagagatattaaatcatgatgttgagtcatttttgactaatttggtcagtcagttttca
gaacgtcgtgacaccttattagcagaaagagaaatttggaaacaaaaagtggataatgga
atgcttcctgattttatttcagaatcagattccattataaactcagaatggaaagtgaat
ccaattcctaaagacttgcaagatcgtcgggtcgaaattacaggccccgtagatcgtaaa
atggtgatcaatgcattaaatgctaatgtaaaagtatttatggcagattttgaggattca
cttgccccgacatgggataaggttattgatggccaaattaatttacgtgatgctgtcaaa
ggaacaatttcctacaccaatgaacaaggtaagtgctatcaactaaaagcatcgcctgcg
gtgttaattgctcgagtcaggggattacacttgccagagaagcatgtgctatggcaggga
aaacctattcctgggtgcttgtttgattttgccttatatttttaccataactataaaaca
ttacaggcaaagggcagcgggccttatttttacattcctaaattacaaacttggcaagag
gcaaaatggtggagtgatgtttttcatttcactgaaaaacgcttcggtttagccagcgga
actattaaagccacagtattaattgaaactttacctgcggtatttcaaatggaagagatc
ttattccatatgaaagagcatattgtgggccttaattgtggacgttgggattatatcttt
agctatatcaaaacgttgaagaattaccctgatcgtgtgttaccggatagacagggtatt
actatgactcaacctttcttaagtgcttattcccgactacttattcaaacttgtcataaa
cgtggtgcatttgcgatgggaggaatgtctgcttttatccccagtcgctctgcggagcaa
aatggtgtcattttacaaaaggtatttgaggataaagagcttgaagcaactaatggtcat
gatggtacttggatagctcaccctggattagccgaaacggtgttatctgcgtttgatgcg
gtattaggagagcgagcaaaccaacttgatgtacaacgtcatgaaaagatcaccgcagaa
atgttattggccccttgtgaaggtgaaagaacagcaacaggaatgagagcgaatatccgt
gttgctgtgcaatatattgaagcgtggatctcaggtaatggttgtgtgcctatttatggg
ctaatggaagatgccgccacggcagagatatctcgaacctctatttggcaatggatccgt
catcaaaaaccattatcggatggacagattgtaacaaaagcgctttttcgcaacatgttg
aaagaagagctggaggtaattcgccaagaagtgggtgatacccgctttgagcaaggtcgt
tttaaagaagcagcgaccttaatggataacattactacccaagatgaattagtcgatttt
ctgactttaccgggttatcaacttttaaattaa

DBGET integrated database retrieval system