KEGG   Proteus mirabilis HI4320: PMI2862Help
Entry
PMI2862           CDS       T00753                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00230  Purine metabolism
pmr01100  Metabolic pathways
Module
pmr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pmr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PMI2862 (gmk)
Enzymes [BR:pmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PMI2862 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 RsgA_GTPase AAA_33 AAA_22 ABC_tran AAA_16 Adeno_IVa2 AAA_29 Viral_helicase1 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: CAR45637
UniProt: B4EZA2
Position
3139962..3140585
Genome map
AA seq 207 aa AA seqDB search
MIQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRPMRPGENHGEHYFFVTEE
EFKSMIASGDFIEHACVFGNYYGTSGKVIKQILASGVDVFLDIDWQGAQQVRKKMPEARS
IFILPPSKEELYRRLRGRGQDSEEVIAKRMSQAVSEMEHFNEYDYLLINDDFNTALADLQ
SIIRSEKLRLDRQTLRHGDLISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaggaacactttatattgtttccgctccaagcggtgcgggtaaatcaagtctt
attcaggctttattaaaaacacagcctttatatgacacacaggtttctgtctctcatact
acccgcccaatgagaccaggagaaaaccatggtgagcattacttctttgtcactgaagaa
gaatttaaaagtatgatagcaagtggagattttatcgaacacgcttgtgtgtttggtaac
tattacggtacatcgggtaaagttatcaaacagatcttagccagtggcgttgatgtcttt
ttagatatcgattggcaaggtgcgcagcaggtacgtaaaaagatgcctgaagctcgcagt
atttttattctgccaccgtctaaagaagagctttaccgccgacttcgcggacgtgggcaa
gatagtgaagaagtgattgctaaacgtatgtcacaagctgtgtctgagatggaacatttt
aatgagtatgactatttgctcatcaatgatgatttcaatactgcgcttgctgatttacaa
tcaatcattcgctcagaaaaattacgccttgatcgtcaaacactacgacatggtgattta
atcagcaaattattggcagactga

DBGET integrated database retrieval system