KEGG   Proteus mirabilis HI4320: PMI2993
Entry
PMI2993           CDS       T00753                                 

Definition
(GenBank) putative membrane protein
Organism
pmr  Proteus mirabilis HI4320
SSDB
Motif
Pfam: Zmiz1_N
Other DBs
NCBI-ProteinID: CAR45890
UniProt: B4F004
Position
3282912..3286013
AA seq 1033 aa
MTGEVNEKYLTPQERKARQMVKAVNEASPRNLPADAVVCPCENEHRPVYPVRYAYTNFYC
DLHFSTIEQAPNKTLEASIPPSINQLLNAKDVTASKGFSARLLRQGWVYVFEEGNYPTRS
NSSNKSYQEQNVDATKGRLLVFQHQVTTSDGNENFIPYIFKQLKNGGVTLKKNGNSNPYL
AIPKDVKEATILFSESKLSDYTLKKIISSSKFRSKLMQKINFIDYNNNDYCIELNKDNLN
RLVEDYKEEVDKFKLFVKEFTHSNIPSSFFSDTTKIPDLPQDATVLINQINSVLDYNEKA
TLLILKDPVGYQKDVLSYYNIVTKLHLLYQNYYSHPDKIGQFITSIQEASHHIKDTDEKE
KMQTILKESINQNALDNEWKNIHKTFIFFEKHQRIVLSLYESFMNNPAIINENGGLKHYF
DYAFSYHERITKEDVFSIDFFKDLNQAFDLYFDLISPLMNSTEGQRTLDKLYSINDEENN
SLWVGVTKKVISLVANSKIMDALLNAQEYAENIENFVNKLAFICSDSIGFAFTKTSKMLS
HYDIKNRLINTKGIDYLAQKILPMILAFCNTKISLTEFVKLSGNELNQWVEQLRKLTEQI
VPNLQHPKLNKLFSWKQKIINLGEETAVLIPKIEITDITKNKIYIYGKDALQVSTKLFLN
GFSMITGSIQAYTLQGMSLYERNDPLKLSPYNLYTAQIIANLFVASYSILKVSQEATKLS
QTVSSTTLKFFLDKIKLPMLTTEVGTKRMAALGKIAGAVGVALATRDALEAFHIGNNKQG
LSNVAIAIGSFMLIFVTGGWALFAGLLILGGFFSSQLTSWSHLETLLRHSFWGNEESSNF
WDNNRPTPIGEQLKQYIKEFEFYEQKGLIELQEFYNLFYTAKMTQEKIPNGKLRLSFEFT
NFTPGISEVYFHFVTEVGYHSGLAEEIKTPSSAYVLNKRKDLLEISEQLKMASEKGDWNP
ETGILKFSLEVQSQLVNTYSAFGAHPNSRIGIEDLYWYYQVNPEVTTPMRYINWGGDTQE
NNRLLGFINSENI
NT seq 3102 nt   +upstreamnt  +downstreamnt
atgactggagaagtgaatgagaaatatttaacaccgcaagagcgcaaagcgcgtcagatg
gtgaaggcggtaaacgaagcgagcccacgaaacttaccggccgacgcggtggtatgccca
tgtgaaaatgaacatcgccctgtttatccggtgcgttatgcatataccaacttttattgt
gatttacatttttctacaattgaacaagcaccaaataaaacgttagaagcgagtattcct
ccttctattaatcaattattgaatgcgaaagatgttactgctagtaaaggattttctgca
agattattaagacaaggttgggtttatgtttttgaagaaggcaattaccctactagaagt
aattctagtaataaaagttatcaagaacaaaatgttgatgcgacaaaaggacgcctatta
gtttttcaacatcaagttacaaccagtgatggcaatgaaaatttcattccatatatattt
aagcaattaaaaaatgggggtgtcactttaaagaaaaacggaaatagtaatccttattta
gctataccgaaagatgtgaaggaagcgactatcttattcagcgaaagtaaattatctgat
tacacacttaaaaaaatcatttcatcttctaagtttagatcgaaattaatgcaaaaaatc
aattttattgattacaacaataacgattattgtattgagctaaataaagataatttaaat
cgacttgttgaggattataaagaagaagttgataaatttaagctatttgttaaagaattc
acgcattcaaatataccctcttcttttttttctgataccacaaaaatacccgacttacca
caagatgcaactgttttgattaatcaaataaatagtgttctagattataatgaaaaagcg
acattgcttattttaaaagatcccgtaggataccaaaaagatgttttatcttattataat
attgtaacaaaattacatttattatatcagaactattatagccatccggataaaattggc
caatttattacgagtatacaagaagctagtcatcacattaaagatactgatgaaaaagaa
aaaatgcaaacaatactaaaagagagtattaatcagaatgcattagataatgagtggaaa
aatattcataaaacatttattttttttgagaaacatcaacgtattgtattatcattgtat
gaaagctttatgaataatccggcaatcattaatgaaaacggtggcttaaaacattatttt
gattatgctttttcatatcacgaacgtataacgaaagaagatgtctttagtattgatttt
tttaaggaccttaatcaagcttttgatttatattttgatttaatatctccattaatgaat
tctaccgaaggacaaagaacattagataaattatattcaattaatgatgaagaaaataat
agcctgtgggtgggagtgacaaagaaagtaattagtcttgttgctaattcaaaaattatg
gacgcacttttaaatgcacaagaatatgcagagaatatcgaaaattttgttaataagctt
gcgtttatttgctcagatagcattggttttgcatttacaaaaacaagtaagatgctttct
cattacgatattaaaaatagactaattaatactaagggtattgactatttagctcaaaag
atacttccgatgatactggcattttgcaacacaaaaatttcattaaccgagtttgttaaa
ttatcgggtaatgagcttaaccagtgggtggaacaactccgtaaattaacggaacaaata
gtaccaaatctgcaacatcctaaattaaataagcttttttcttggaaacaaaaaataata
aatctaggcgaagagactgccgttcttattccgaagattgagatcacagatattactaaa
aataagatttatatttatggtaaagatgcattacaggtttccactaagctatttttaaac
ggtttcagcatgatcaccggatcaatccaagcttatacattacaaggtatgagtttgtat
gaacgtaatgacccattaaaactatccccctataatctgtatacagcacagattattgcg
aatttatttgtagcaagctacagtattttaaaagtttctcaagaggcgacaaaattatct
caaacagtatcgagcaccacactgaaattctttttagataaaataaaattacctatgcta
acaacagaagtgggaaccaaaagaatggcagcattaggtaagattgcaggtgccgttggt
gttgctcttgccactcgagatgcattagaagcttttcatattggaaataataaacaaggt
ttatcaaatgtagccattgccattggttctttcatgctaatttttgttacagggggatgg
gctctatttgcaggactgctaatattaggaggcttcttctcaagtcaactcaccagttgg
agtcatttggaaactttgctaaggcacagtttttggggaaatgaagaaagttcaaatttt
tgggataataatagaccaacaccgataggagaacaattaaaacaatatataaaagaattt
gaattctatgaacaaaaagggctaattgaattacaagagttttataatctattttataca
gctaaaatgactcaagaaaaaataccaaatggaaaactccgcttatcttttgaatttact
aattttaccccagggatttcagaagtatattttcactttgttacagaggttggttatcac
agcggcttggcagaagaaataaaaacacctagttcagcttatgttctaaataaacgaaaa
gacctcttagaaattagcgaacaattaaaaatggcaagtgaaaaaggtgattggaaccct
gaaacaggtatattgaaatttagtttggaagtacagtctcaattagtaaatacatattct
gcttttggtgcacatcctaatagccgtataggtattgaagatttatattggtattatcaa
gtcaatcccgaggtaacaacaccgatgcgttatatcaattgggggggagatacccaagaa
aacaatcggcttttaggctttattaacagtgagaatatctaa

DBGET integrated database retrieval system