KEGG   Proteus mirabilis HI4320: PMI3132Help
Entry
PMI3132           CDS       T00753                                 

Gene name
dnaA
Definition
(GenBank) chromosomal replication initiator protein
  KO
K02313  chromosomal replication initiator protein
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PMI3132 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pmr03032]
    PMI3132 (dnaA)
   03036 Chromosome and associated proteins [BR:pmr03036]
    PMI3132 (dnaA)
DNA replication proteins [BR:pmr03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    PMI3132 (dnaA)
Chromosome and associated proteins [BR:pmr03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    PMI3132 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA AAA_16 Kinesin AAA_14 AAA_22 ATPase_2 AFG1_ATPase NACHT RNA_helicase PhoH AAA_19 BLOC1S3
Motif
Other DBs
NCBI-ProteinID: CAR46152
UniProt: B4F0U5
Position
3445820..3447220
Genome map
AA seq 466 aa AA seqDB search
MSLSLWQHCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVREKYINNIN
ALLVDFCGSDVPSLRFEVGNKPVSARTTESVPKTVTHPAVNSTPTNSQPVRPSWDNQPQS
QLPELNYRSNVNPKHKFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHL
LHAVGNSIMERKANAKVVYMHSERFVQDMVKALQNNAIEDFKRYYRSVDALLIDDIQFFA
NKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELET
RVAILMKKADENQIQLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVRE
ALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHS
LPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgtcactttcgctttggcagcattgtcttgcccgattgcaggatgagttacctgccact
gaatttagtatgtggatacgtcccttgcaggcagaactaagcgataacacgctggcactg
tatgcacctaatcgttttgtgttagattgggtaagagaaaagtacattaataatattaat
gcgttattagtcgacttttgtggttctgatgtcccttcgttgcgttttgaagtggggaat
aaacctgtatcagcacgtaccaccgagagtgttcccaaaaccgtgacacatcccgcggtt
aattccacaccgactaacagccagcctgtgcgtcctagctgggataatcaaccgcaatcc
cagttacctgaacttaattatcgttctaatgtgaatcctaaacataaatttgataatttc
gttgaaggtaaatcgaaccaacttgctagagctgccgcaagacaagttgctgataatcct
ggaggagcttataacccactgtttttatatgggggaacgggtctgggtaaaacgcatcta
ttgcatgcggtgggcaacagtattatggaacgtaaagccaatgctaaagttgtttatatg
cattcggaacgtttcgtgcaagatatggtaaaggcgttacaaaataatgctattgaagat
tttaaacgctactatcgctctgtagacgcgctattaattgatgatattcaattttttgcc
aataaagagcgttcacaagaagagttttttcatacctttaacgctttgttagagggaaat
cagcaaattattttaacctcagaccgttatcctaaagagattaacggggtagaggatcga
ttaaaatcgcgctttggttggggattgactgtagccattgaaccaccagaattagaaacg
cgtgtggcgattttgatgaaaaaagcggacgaaaatcaaatccagttacctgatgaagtg
gcgttttttattgctaaacgactccgctctaacgtccgtgaactagaaggtgcattaaac
cgagtaatagctaacgcaaattttaccggtcgagccattaccatcgactttgtgcgtgaa
gcattacgtgatttactcgcattacaagagaaactcgttactatcgataatattcagaaa
actgtagcagaatattataaaattaaggtagcggatttgttgtcgaagcgacgatcccga
tcggttgcccgtccgaggcaaatggcaatggcgctggcaaaggaattaacaaaccacagc
ttgcctgaaatcggggatgcctttggtggtcgtgaccatactacggtactgcatgcttgc
cgaaaaatagagcaactgcgtgaagaaagtcacgatatcaaagaagatttttctaactta
atcagaacattatcatcctag

DBGET integrated database retrieval system