KEGG   Proteus mirabilis HI4320: PMI3155Help
Entry
PMI3155           CDS       T00753                                 

Gene name
coaBC
Definition
(GenBank) coenzyme A biosynthesis bifunctional protein [includes: phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase]
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00770  Pantothenate and CoA biosynthesis
pmr01100  Metabolic pathways
Module
pmr_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PMI3155 (coaBC)
Enzymes [BR:pmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     PMI3155 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     PMI3155 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein YjeF_N
Motif
Other DBs
NCBI-ProteinID: CAR46200
UniProt: B4F0W7
Position
complement(3467823..3469031)
Genome map
AA seq 402 aa AA seqDB search
MTTLHDKKIILGISGGIAAYKAPELVRRLRDKGAIVRVVMTPAAHAFVTPLSLQAVSGFP
VADDLLDPAAEAAMGHIELGKWADLILLAPATADLIARLRMGMANDLLTTLCLASAAPIA
IAPAMNQQMYRATITQENLTALAQRGCLIWGPDSGSQACGDVGPGRMLDPLELVALAEQQ
FAIQHDFKGKKITITAGPTREALDPVRFISNHSSGKMGFAIAQAAAQRGAEVTLIAGPVT
LPTPACVKRIDVESAQEMYQQVMNIAPSQDIFIGCAAVADYRAKQVAPEKIKKQGDEVTI
TMIKNPDIVASVGKMVEHRPFVVGFAAETQNVEEYARRKREQKQLDLICANDVSLKDAGF
NSDNNALHLIWANGETRLPHSSKTQLSHRLLDEIAKHYDEKN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactacacttcacgacaaaaagattattctgggtatcagtggtggtattgcggcctat
aaagcgcctgagctagtccgtcgtttacgtgataaaggcgctattgtgcgcgtcgttatg
acgcctgcagcacatgcctttgtcaccccgttatcgctacaagcggtatcaggcttccct
gttgcggatgatttgcttgatcctgccgcagaagccgcaatgggacatatcgaactaggg
aaatgggctgatctgattttattagcccctgctaccgcagatttaattgctcgtttacgc
atggggatggcaaacgatctgttaaccacactctgtttagccagtgcagcacctattgcg
attgccccagcgatgaatcaacaaatgtatcgtgcgacgattacacaagaaaatttaacg
gctttggcacaacgaggttgtcttatctgggggcctgactctggtagccaagcctgtggt
gatgttggacccggtagaatgttagatcctcttgaattggtggcattagcagagcaacaa
tttgcaattcaacacgattttaaaggtaaaaaaattaccattaccgcaggcccaacacgt
gaagccttagatccagtacgctttatcagcaaccatagctcaggaaaaatgggctttgct
attgcgcaagcggccgctcaacggggagcagaagtgacactcattgccggccctgtcaca
ttgccgacacctgcttgtgttaaacgtatcgacgtcgaaagtgcccaagagatgtatcaa
caagtgatgaatattgcgccatcccaagatatttttattggttgtgctgccgttgccgat
tatcgagccaaacaggttgcccctgaaaaaattaaaaaacaaggtgatgaagtaacgata
actatgataaaaaaccccgatattgttgccagtgtcggaaaaatggttgagcatcgccca
tttgttgtcggatttgcagccgaaacccagaatgtggaagaatatgcccgccgtaaacga
gaacaaaaacaactcgatttaatctgtgctaatgatgtatcactaaaagatgctggtttt
aatagtgataacaacgcattacaccttatctgggcaaatggagaaacgcgtttaccacat
agtagtaaaacgcaactgagtcatcgcctacttgacgagatagccaaacattatgatgaa
aaaaattga

DBGET integrated database retrieval system