KEGG   Proteus mirabilis HI4320: PMIP12
Entry
PMIP12            CDS       T00753                                 

Gene name
pilX6
Definition
(GenBank) putative conjugal transfer protein
  KO
K03201  type IV secretion system protein VirB6
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PMIP12 (pilX6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmr02044]
    PMIP12 (pilX6)
Secretion system [BR:pmr02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   PMIP12 (pilX6)
SSDB
Motif
Pfam: TrbL
Other DBs
NCBI-ProteinID: CAQ34859
UniProt: B1VJ50
Position
pHI4320:7422..8579
AA seq 385 aa
MATTQDAVDSYWGTGLNGGSANFVVPSKPPLEGQPAQYDSNFFQTAHEIITDILKSSTQG
KMGEFIDIAYSLGKFGVQAYILWYIFTILAGKQQKTVPVQDFIWNVVRFTVILLFVRNVD
GWLDTSISSIYGLKNLFAGGDVYLWLDQLWVKTVQTANLIFKLDPSDYVPAAGALGALFT
YLGGLVALMCAALTFFAAEVTLMLLTITAPLFIMCLMFGFLRQMFNSWLQMIFSALLIFL
FGGLALRAGTWYLNTILTTNIATASEQNLIYMGASALAGGIFMAFVIWQAKTYASQIAGV
GAEGALQGAAAMGLAAGGFGMGRMALGGLRMGKNASSGLGRGLVGQSGGFGKSEGFSGKA
GNVTGQATRRIGKEVAAIYKKRFGG
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggcaaccacacaagatgcagtagattcttattggggaaccggactcaacggcggcagt
gctaattttgttgtgccaagtaaaccgccattagagggacagccagcccaatatgacagt
aattttttccagactgcacatgagattattactgatatattaaaatcgtccacgcagggc
aaaatgggcgaatttattgatatcgcttattctctcggtaagtttggagttcaggcgtat
atcctctggtatatttttaccatccttgcgggaaaacagcaaaaaaccgttccggttcag
gattttatctggaatgttgttaggtttactgtgatattgctgtttgtccgtaacgtggat
ggttggctggatacgtctatttcatccatttacgggctgaaaaacctgtttgcgggcggg
gatgtttatctttggcttgatcagctttgggtcaaaactgtgcaaacagcaaaccttatt
ttcaaattagatccctcagattatgtgccggcagcaggagcactaggcgcattatttacc
tatttaggcgggttagttgccctgatgtgtgccgccctgacgttctttgcggcggaagtg
accctgatgttacttactatcactgcacccttgtttattatgtgtctgatgttcggtttt
ctacgccagatgtttaacagttggttgcagatgattttcagtgctctgcttatttttctg
ttcggtggtttggctctacgggcgggaacgtggtatctgaacacgatactgacgaccaac
attgctacggcgagtgaacagaacctgatttatatgggcgcgagtgcgctggcaggcggg
atttttatggcgtttgttatctggcaggcaaaaacctatgcctcacagattgccggagtc
ggggctgagggcgcattgcagggagcggctgctatggggcttgccgcaggcggttttggt
atgggacgcatggctttaggcggtttacgaatggggaaaaacgcaagctctggtttggga
cggggacttgtcgggcaatccggcggatttggtaaatcggaaggcttttccggtaaagca
gggaatgtgaccggacaggcgacacgccggatcggaaaagaggtcgcggcgatttataaa
aaacggtttgggggatga

DBGET integrated database retrieval system