KEGG   Proteus mirabilis HI4320: PMIP13Help
Entry
PMIP13            CDS       T00753                                 

Gene name
pilX8
Definition
(GenBank) conjugal transfer protein
  KO
K03203  type IV secretion system protein VirB8
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PMIP13 (pilX8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pmr02044]
    PMIP13 (pilX8)
Secretion system [BR:pmr02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   PMIP13 (pilX8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: CAQ34861
UniProt: B1VJ53
Position
pHI4320:8719..9426
Genome map
AA seq 235 aa AA seqDB search
MKKIQFFKNKETAIENAALFEDVIYKKEQRLKWVYLGTGILGALIGVLSLIALIIVLPLK
ETETYIYSVDNQTGRAEEMTKVTNSTLNENEAVSRFFVDTYLKAREGYNYFRLQQDYDLV
MSYSSDSVGNEYTAIFKSPQAPQTIYRKGEQTVKVDVLSKIISDSSKADDPDKLASVRYK
RTITEVLTGSKREEFWVARITFRFIPENNLTREERDSNPLGFVVTSYLTEKENRG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattcaattttttaaaaacaaagaaactgccatagaaaacgcggcgttattt
gaagatgtgatttataaaaaagaacaacgtctgaaatgggtttacttaggaacgggtatt
ttaggggctttaattggtgtgctgagtctgattgctcttattattgttttaccgctgaaa
gaaacggaaacatatatttattccgttgataatcagactggcagagcagaagaaatgaca
aaagtcacgaacagtacattaaatgaaaatgaagcggtaagtcgtttctttgttgatacc
tatctcaaagctagagagggatataattattttcgtttgcaacaggattatgatctggtc
atgtcatacagcagtgacagtgtgggaaatgaatacactgctatatttaaatctccacaa
gcaccgcagacgatttacaggaaaggtgaacaaacggttaaggttgacgttttatcaaaa
attatttcggattcatcaaaagctgacgaccctgataagcttgccagtgttcgttacaaa
cggacaattaccgaagttttaacgggttctaaacgtgaagaattttgggttgcaagaatc
acatttcgctttattcctgaaaacaacctgacacgggaagaaagagacagcaatccattg
gggtttgttgttaccagttatttaacagaaaaggaaaacaggggttaa

DBGET integrated database retrieval system