KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00206Help
Entry
KNP414_00206      CDS       T01550                                 

Definition
(GenBank) putative glucokinase, ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00010  Glycolysis / Gluconeogenesis
pms00052  Galactose metabolism
pms00500  Starch and sucrose metabolism
pms00520  Amino sugar and nucleotide sugar metabolism
pms00521  Streptomycin biosynthesis
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
Module
pms_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pms_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KNP414_00206
   00052 Galactose metabolism
    KNP414_00206
   00500 Starch and sucrose metabolism
    KNP414_00206
   00520 Amino sugar and nucleotide sugar metabolism
    KNP414_00206
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KNP414_00206
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KNP414_00206
Enzymes [BR:pms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KNP414_00206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEI38849
UniProt: F8FKY9
Position
211507..212430
Genome map
AA seq 307 aa AA seqDB search
MGGTAIKVGLCDEQGKLLQTYEGPTGTEHGADVVLENIAQYVRKLVAESPYEWEQVAGVG
AGIAGFMDIPEGFMKLSPNLGWRNVPVKKILEEKLGVPVKIDNDANVAALGEAWSGAGAG
IPNVVCYTLGTGVGGGIIIHSRIYQGSNGMAGELGHMVVVPDLEAIECGCGKKGCLETVS
SGTGIIRMAKEAVARGEHTSLALVENIMAKDVFDAAKTGDETALRIINRAALYLGKSMAA
VSVVLNPKRFIVGGGVSKAGDILFDAIRKYYQEFTQETAQEGVDIVPAVLGNDAGVVGAA
GLNLHSI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttgggaggaaccgcgattaaagtgggattgtgcgacgagcagggcaagcttctgcagacg
tacgaaggcccgaccggtaccgaacacggcgcggatgtcgtgctggagaatatcgcacaa
tatgtgcgcaagctggtggcggaatccccttatgagtgggagcaggttgccggagtcggt
gcggggatcgccgggtttatggatattccggaaggcttcatgaagctgtctcccaacctg
ggctggcgcaacgttccggtgaagaagattctcgaggagaagctcggcgtgcctgtcaaa
atcgacaacgacgccaatgtagcggcactcggcgaagcatggagcggagcgggtgcaggc
attccgaacgtcgtctgctatacgcttggaacaggcgttggcggtggcattatcatccac
agccggatttatcagggctccaacggtatggcaggagagcttggtcatatggtggtcgta
ccggacctggaagcgatcgagtgcggatgcggtaagaagggctgcctcgagaccgtatct
tcgggaacgggcattattcgcatggccaaagaagccgtggcgcgtggagagcatacttcc
ctggccctggtggagaacatcatggcgaaggacgtattcgatgcggcgaagaccggcgac
gaaaccgcactgcggatcattaaccgggcagcgctgtacctgggcaaatcgatggcggcg
gtatccgtcgtgctgaacccgaagcggttcatcgtgggcggcggggtgtccaaagccggt
gatattctgttcgatgccattcgtaagtattaccaggaattcacccaggagactgcgcag
gaaggcgtggatattgttccggccgtgctcggcaacgatgccggcgtagtgggcgcagca
ggactgaatctgcacagcatctaa

DBGET integrated database retrieval system