KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00337Help
Entry
KNP414_00337      CDS       T01550                                 

Definition
(GenBank) Mannitol dehydrogenase domain protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00051  Fructose and mannose metabolism
pms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KNP414_00337
Enzymes [BR:pms01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     KNP414_00337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N UDPG_MGDP_dh_N ApbA NmrA
Motif
Other DBs
NCBI-ProteinID: AEI38962
UniProt: F8FNC5
Position
335184..336338
Genome map
AA seq 384 aa AA seqDB search
MKAVHFGAGNIGRGFIGLLLSRAGYEVCFVDVNEMLVSELQSRGEYTVSLASDGRETYNV
TGVTALHGGDTDRVAEAVAGADLVTTAVGVNILKHIAEGIAKGVKLRLQAGGGPQHLIAC
ENAIGGSAQLQAHVFGYLSEEEQRLAEGRLAFPNAAVDRIVPLQHHEDPLHVTVEPFYEW
VVDRSQTLPGLPEIPGVHYADGLEPYIERKLFTVNTGHCCAAYMGFLHGKSTIQESMADE
RIAAEVRAVLGETGRLLTAKHGFDAGEHQAYIEKTMERFRNPHLTDEVARVGRSPVRKLS
PNDRLVRPALGLHDMGVRPAALARAMAAALKFRAEDDPEVQQIRAELEEHGLSAAVSKFT
SLAADHPVHALIVEQYETLSRELA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtccattttggggcggggaacatcggccgcggcttcatcgggctgctgctg
tcccgcgccggctatgaggtgtgtttcgtagacgtcaatgagatgctggtatccgagctg
cagagcagaggcgaatacacggtctccctggccagtgacgggcgggagacctacaacgtc
acgggtgtaaccgcgctgcatggcggagacacggaccgggtcgcggaagcggtggccggg
gcggacctcgtcaccacggcggtcggcgtcaatatcctgaagcatatcgccgaaggcatt
gcgaagggcgtgaagctccgccttcaggccggaggcggcccgcagcacctgatcgcctgc
gagaatgcgatcggcggcagtgcgcagctccaggcgcatgtcttcggctatctgagcgaa
gaggagcagcggctggccgagggccggctcgctttcccgaatgcggcggtcgaccggatc
gtgccgctgcagcatcacgaggacccgcttcacgtaaccgtggagccgttctacgagtgg
gtcgtggaccgttcgcagacgctcccgggtcttccggagatcccgggtgtgcattacgcc
gacggactcgagccctacatcgagcggaagctgttcacggtcaacaccggccactgctgc
gccgcttacatgggcttcctgcacggcaaatcgacgatccaggagagcatggccgatgag
cgcatcgcggccgaagtgcgcgccgtactcggcgagacgggccggctgctcacggcgaag
cacggcttcgatgcgggggagcaccaggcttacatcgagaagacgatggagcgcttccgc
aacccgcatctgaccgatgaggtcgcccgggtcggccgctccccggtccgcaagctctcg
ccgaacgaccgtctggtccgtccggcgctggggctgcatgacatgggcgtccgtcccgcg
gcgctggcccgggccatggcggccgcgctgaagttccgggcggaggatgacccggaagtg
cagcagatccgggcagagctggaggagcacggcttgtccgccgcggtcagcaagttcact
tcccttgcggcggaccatccggtgcacgcgctcatcgtcgagcagtacgagacgctcagc
cgggagctggcgtaa

DBGET integrated database retrieval system